Recombinant Full Length Mouse Sodium/Potassium-Transporting Atpase Subunit Beta-1-Interacting Protein 4(Nkain4) Protein, His-Tagged
Cat.No. : | RFL35041MF |
Product Overview : | Recombinant Full Length Mouse Sodium/potassium-transporting ATPase subunit beta-1-interacting protein 4(Nkain4) Protein (Q9JMG4) (1-208aa), fused to N-terminal His tag, was expressed in E. coli. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Mus musculus |
Source : | E.coli |
Tag : | His |
Protein Length : | Full Length (1-208) |
Form : | Lyophilized powder |
AA Sequence : | MGFCSGRCTLLALCALQLVTALERQVFDFLGYQWAPILANFTHIIVVILGLFGTIQYRPR YIVVYVVWAAVWVTWNVFIICFYLEVGGLSKDSELLTFNLSGHRSWWEEHGPGCLHEEEA TAGLGALHGQSLVVGAGCAMVHSYVEALHSGLQILLALLGFVYGCYVVSVLTEEEDSFDF IGGFDPFPLYHVNEKPSSLLSKQAYLPA |
Purity : | Greater than 90% as determined by SDS-PAGE. |
Notes : | Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week. |
Storage : | Store at -20°C/-80°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. |
Storage Buffer : | Tris/PBS-based buffer, 6% Trehalose, pH 8.0 |
Reconstitution : | We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20℃/-80℃. Our default final concentration of glycerol is 50%. Customers could use it as reference. |
Gene Name | Nkain4 |
Synonyms | Nkain4; Fam77a; Sodium/potassium-transporting ATPase subunit beta-1-interacting protein 4; Na(+/K(+-transporting ATPase subunit beta-1-interacting protein 4; Protein FAM77A |
UniProt ID | Q9JMG4 |
◆ Recombinant Proteins | ||
NKAIN4-1299H | Recombinant Human NKAIN4, GST-tagged | +Inquiry |
NKAIN4-6359Z | Recombinant Zebrafish NKAIN4 | +Inquiry |
RFL20618XF | Recombinant Full Length Xenopus Laevis Sodium/Potassium-Transporting Atpase Subunit Beta-1-Interacting Protein 4(Nkain4) Protein, His-Tagged | +Inquiry |
NKAIN4-7854H | Recombinant Human NKAIN4 protein, His-tagged | +Inquiry |
NKAIN4-10686M | Recombinant Mouse NKAIN4 Protein | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews (0)
- Q&As (0)
Ask a Question for All Nkain4 Products
Required fields are marked with *
My Review for All Nkain4 Products
Required fields are marked with *
0
Inquiry Basket