Recombinant Full Length Mouse Sphingosine 1-Phosphate Receptor 5(S1Pr5) Protein, His-Tagged
Cat.No. : | RFL14691MF |
Product Overview : | Recombinant Full Length Mouse Sphingosine 1-phosphate receptor 5(S1pr5) Protein (Q91X56) (1-400aa), fused to N-terminal His tag, was expressed in E. coli. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Mus musculus |
Source : | E.coli |
Tag : | His |
Protein Length : | Full Length (1-400) |
Form : | Lyophilized powder |
AA Sequence : | MEPGLLRPAPVSEVIVLHYNYTGKLRGARYQPGAGLRADAAVCLAVCAFIVLENLAVLLV LVRHPRFHAPMFLLLGSLTLSDLLAGAAYATNILLSGPLTLRLSPALWFAREGGVFVALA ASVLSLLAIALERHLTMARRGPAPAASRARTLAMAVAAWGASLLLGLLPALGWNCLGRLE TCSTVLPLYAKAYVLFCVLAFLGILAAICALYARIYCQVRANARRLRAGPGSRRATSSSR SRHTPRSLALLRTLSVVLLAFVACWGPLFLLLLLDVACPARACPVLLQADPFLGLAMANS LLNPIIYTFTNRDLRHALLRLLCCGRGPCNQDSSNSLQRSPSAAGPSGGGLRRCLPPTLD RSSSPSEHLSPQQDGVDTSCSTGSPGVATANRSLVPTATD |
Purity : | Greater than 90% as determined by SDS-PAGE. |
Notes : | Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week. |
Storage : | Store at -20°C/-80°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. |
Storage Buffer : | Tris/PBS-based buffer, 6% Trehalose, pH 8.0 |
Reconstitution : | We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20℃/-80℃. Our default final concentration of glycerol is 50%. Customers could use it as reference. |
Gene Name | S1pr5 |
Synonyms | S1pr5; Edg8; Lpb4; Sphingosine 1-phosphate receptor 5; S1P receptor 5; S1P5; Endothelial differentiation G-protein-coupled receptor 8; Lysophospholipid receptor B4; Sphingosine 1-phosphate receptor Edg-8; S1P receptor Edg-8 |
UniProt ID | Q91X56 |
◆ Recombinant Proteins | ||
S1PR5-2154H | Recombinant Human S1PR5 Full Length Transmembrane protein(VLPs) | +Inquiry |
S1PR5-4743HF | Recombinant Full Length Human S1PR5 Protein, GST-tagged | +Inquiry |
S1PR5-14632M | Recombinant Mouse S1PR5 Protein | +Inquiry |
S1PR5-5221R | Recombinant Rat S1PR5 Protein | +Inquiry |
S1PR5-4880R | Recombinant Rat S1PR5 Protein, His (Fc)-Avi-tagged | +Inquiry |
◆ Cell & Tissue Lysates | ||
S1PR5-2082HCL | Recombinant Human S1PR5 293 Cell Lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews (0)
- Q&As (0)
Ask a Question for All S1pr5 Products
Required fields are marked with *
My Review for All S1pr5 Products
Required fields are marked with *