Recombinant Full Length Mouse T-Cell Immunoreceptor With Ig And Itim Domains(Tigit) Protein, His-Tagged
Cat.No. : | RFL31627MF |
Product Overview : | Recombinant Full Length Mouse T-cell immunoreceptor with Ig and ITIM domains(Tigit) Protein (P86176) (29-249aa), fused to N-terminal His tag, was expressed in E. coli. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Mus musculus |
Source : | E.coli |
Tag : | His |
Protein Length : | Full Length of Mature Protein (29-249) |
Form : | Lyophilized powder |
AA Sequence : | TIDTKRNISAEEGGSVILQCHFSSDTAEVTQVDWKQQDQLLAIYSVDLGWHVASVFSDRVVPGPSLGLTFQSLTMNDTGEYFCTYHTYPGGIYKGRIFLKVQESSDDRNGLAQFQTAPLGGTMAAVLGLICLMVTGVTVLARKDKSIRMHSIESGLGRTEAEPQEWNLRSLSSPGSPVQTQTAPAGPCGEQAEDDYADPQEYFNVLSYRSLESFIAVSKTG |
Purity : | Greater than 90% as determined by SDS-PAGE. |
Applications : | SDS-PAGE |
Notes : | Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week. |
Storage : | Store at -20°C/-80°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. |
Storage Buffer : | Tris/PBS-based buffer, 6% Trehalose, pH 8.0 |
Reconstitution : | We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20℃/-80℃. Our default final concentration of glycerol is 50%. Customers could use it as reference. |
Gene Name | Tigit |
Synonyms | Tigit; Vstm3; T-cell immunoreceptor with Ig and ITIM domains; V-set and transmembrane domain-containing protein 3 |
UniProt ID | P86176 |
◆ Recombinant Proteins | ||
Tigit-2348MAF488 | Recombinant Mouse Tigit Protein, His-tagged, Alexa Fluor 488 conjugated | +Inquiry |
TIGIT-1031H | Recombinant Human TIGIT Protein, DDK/His-tagged | +Inquiry |
TIGIT-360H | Recombinant Human TIGIT protein, His-Avi-tagged, Biotinylated | +Inquiry |
TIGIT-106HAF647 | Recombinant Human TIGIT Protein, His-tagged, Alexa Fluor 647 conjugated | +Inquiry |
TIGIT-4486H | Recombinant Human TIGIT protein, His-SUMO-tagged | +Inquiry |
◆ Cell & Tissue Lysates | ||
TIGIT-2610HCL | Recombinant Human TIGIT cell lysate | +Inquiry |
TIGIT-1420MCL | Recombinant Mouse TIGIT cell lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews (0)
- Q&As (0)
Ask a Question for All Tigit Products
Required fields are marked with *
My Review for All Tigit Products
Required fields are marked with *