Recombinant Full Length Mouse T-Cell Immunoreceptor With Ig And Itim Domains(Tigit) Protein, His-Tagged
| Cat.No. : | RFL31627MF |
| Product Overview : | Recombinant Full Length Mouse T-cell immunoreceptor with Ig and ITIM domains(Tigit) Protein (P86176) (29-249aa), fused to N-terminal His tag, was expressed in E. coli. |
- Specification
- Gene Information
- Related Products
- Download
| Species : | Mouse |
| Source : | E.coli |
| Tag : | His |
| Protein Length : | Full Length of Mature Protein (29-249) |
| Form : | Lyophilized powder |
| AA Sequence : | TIDTKRNISAEEGGSVILQCHFSSDTAEVTQVDWKQQDQLLAIYSVDLGWHVASVFSDRVVPGPSLGLTFQSLTMNDTGEYFCTYHTYPGGIYKGRIFLKVQESSDDRNGLAQFQTAPLGGTMAAVLGLICLMVTGVTVLARKDKSIRMHSIESGLGRTEAEPQEWNLRSLSSPGSPVQTQTAPAGPCGEQAEDDYADPQEYFNVLSYRSLESFIAVSKTG |
| Purity : | Greater than 90% as determined by SDS-PAGE. |
| Applications : | SDS-PAGE |
| Notes : | Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week. |
| Storage : | Store at -20°C/-80°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. |
| Storage Buffer : | Tris/PBS-based buffer, 6% Trehalose, pH 8.0 |
| Reconstitution : | We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20℃/-80℃. Our default final concentration of glycerol is 50%. Customers could use it as reference. |
| Gene Name | Tigit |
| Synonyms | Tigit; Vstm3; T-cell immunoreceptor with Ig and ITIM domains; V-set and transmembrane domain-containing protein 3 |
| UniProt ID | P86176 |
| ◆ Recombinant Proteins | ||
| Tigit-693M | Active Recombinant Mouse Tigit, Fc Chimera | +Inquiry |
| Tigit-2348MF | Recombinant Mouse Tigit Protein, His-tagged, FITC conjugated | +Inquiry |
| TIGIT-727H | Recombinant Human TIGIT Protein | +Inquiry |
| TIGIT-356H | Active Recombinant Human TIGIT Protein (Met22-Pro141, A103), C-Fc-tagged | +Inquiry |
| TIGIT-12H | Recombinant Human TIGIT Protein, C-6His-Avi tagged, Biotinylated | +Inquiry |
| ◆ Cell & Tissue Lysates | ||
| TIGIT-2610HCL | Recombinant Human TIGIT cell lysate | +Inquiry |
| TIGIT-1420MCL | Recombinant Mouse TIGIT cell lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews (0)
- Q&As (0)
Ask a Question for All Tigit Products
Required fields are marked with *
My Review for All Tigit Products
Required fields are marked with *
