Recombinant Full Length Mouse Tetraspanin-7(Tspan7) Protein, His-Tagged
| Cat.No. : | RFL27277MF |
| Product Overview : | Recombinant Full Length Mouse Tetraspanin-7(Tspan7) Protein (Q62283) (1-249aa), fused to N-terminal His tag, was expressed in E. coli. |
- Specification
- Gene Information
- Related Products
- Download
| Species : | Mouse |
| Source : | E.coli |
| Tag : | His |
| Protein Length : | Full Length (1-249) |
| Form : | Lyophilized powder |
| AA Sequence : | MASRRMETKPVITCLKTLLIIYSFVFWITGVILLAVGVWGKLTLGTYISLIAENSTNAPY VLIGTGTTIVVFGLFGCFATCRGSPWMLKLYAMFLSLVFLAELVAGISGFVFRHEIKDTF LRTYTDAMQNYNGNDERSRAVDHVQRSLSCCGVQNYTNWSSSPYFLDHGIPPSCCMNETD CNPLDLHNLTVAATKVNQKGCYDLVTSFMETNMGIIAGVAFGIAFSQLIGMLLACCLSRF ITANQYEMV |
| Purity : | Greater than 90% as determined by SDS-PAGE. |
| Notes : | Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week. |
| Storage : | Store at -20°C/-80°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. |
| Storage Buffer : | Tris/PBS-based buffer, 6% Trehalose, pH 8.0 |
| Reconstitution : | We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20℃/-80℃. Our default final concentration of glycerol is 50%. Customers could use it as reference. |
| Gene Name | Tspan7 |
| Synonyms | Tspan7; Mxs1; Tm4sf2; Tetraspanin-7; Tspan-7; Cell surface glycoprotein A15; PE31; TALLA homolog; Transmembrane 4 superfamily member 2; CD antigen CD231 |
| UniProt ID | Q62283 |
| ◆ Recombinant Proteins | ||
| TSPAN7-12791Z | Recombinant Zebrafish TSPAN7 | +Inquiry |
| TSPAN7-5141H | Recombinant Human TSPAN7 Protein (Arg113-Met213), C-His tagged | +Inquiry |
| TSPAN7-237H | Recombinant Human TSPAN7 protein | +Inquiry |
| TSPAN7-5004R | Recombinant Rhesus monkey TSPAN7 Protein, His-tagged | +Inquiry |
| TSPAN7-571HF | Recombinant Full Length Human TSPAN7 Protein | +Inquiry |
| ◆ Cell & Tissue Lysates | ||
| TSPAN7-863HCL | Recombinant Human TSPAN7 cell lysate | +Inquiry |
| TSPAN7-813CCL | Recombinant Cynomolgus TSPAN7 cell lysate | +Inquiry |
| TSPAN7-861MCL | Recombinant Mouse TSPAN7 cell lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews (0)
- Q&As (0)
Ask a Question for All Tspan7 Products
Required fields are marked with *
My Review for All Tspan7 Products
Required fields are marked with *



