Recombinant Full Length Mouse Tm2 Domain-Containing Protein 1(Tm2D1) Protein, His-Tagged
| Cat.No. : | RFL19335MF |
| Product Overview : | Recombinant Full Length Mouse TM2 domain-containing protein 1(Tm2d1) Protein (Q99MB3) (38-208aa), fused to N-terminal His tag, was expressed in E. coli. |
- Specification
- Gene Information
- Related Products
- Download
| Species : | Mouse |
| Source : | E.coli |
| Tag : | His |
| Protein Length : | Full Length of Mature Protein (38-208) |
| Form : | Lyophilized powder |
| AA Sequence : | SGAVGGEETPKCEDLRVGQYICKEPKINDATQEPVNCTNYTAHVQCFPAPKITCKDLSGN ETHFTGSEVGFLKPISCRNVNGYSYKVAVALSLFLGWLGADRFYLGYPALGLLKFCTVGF CGIGSLIDFILISMQIVGPSDGSSYIIDYYGTRLTRLSITNETFRKTQLYP |
| Purity : | Greater than 90% as determined by SDS-PAGE. |
| Notes : | Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week. |
| Storage : | Store at -20°C/-80°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. |
| Storage Buffer : | Tris/PBS-based buffer, 6% Trehalose, pH 8.0 |
| Reconstitution : | We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20℃/-80℃. Our default final concentration of glycerol is 50%. Customers could use it as reference. |
| Gene Name | Tm2d1 |
| Synonyms | Tm2d1; Bbp; TM2 domain-containing protein 1; Amyloid-beta-binding protein; mBBP |
| UniProt ID | Q99MB3 |
| ◆ Recombinant Proteins | ||
| RFL18204DF | Recombinant Full Length Danio Rerio Tm2 Domain-Containing Protein 1(Tm2D1) Protein, His-Tagged | +Inquiry |
| TM2D1-16835M | Recombinant Mouse TM2D1 Protein | +Inquiry |
| TM2D1-5758Z | Recombinant Zebrafish TM2D1 | +Inquiry |
| TM2D1-1929H | Active Recombinant Human TM2 Domain Containing 1 | +Inquiry |
| TM2D1-1582HF | Recombinant Full Length Human TM2D1 Protein, GST-tagged | +Inquiry |
| ◆ Cell & Tissue Lysates | ||
| TM2D1-1039HCL | Recombinant Human TM2D1 293 Cell Lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews (0)
- Q&As (0)
Ask a Question for All Tm2d1 Products
Required fields are marked with *
My Review for All Tm2d1 Products
Required fields are marked with *



