Recombinant Full Length Mouse TNFRSF9 Protein, Fc-tagged

Cat.No. : TNFRSF9-583M
Product Overview : Recombinant Mouse TNFRSF9 protein with Fc tag was expressed in HEK293.
  • Specification
  • Gene Information
  • Related Products
  • Download
Species : Mouse
Source : HEK293
Tag : Fc
Protein Length : 1-256 a.a.
Description : Enables cytokine binding activity; identical protein binding activity; and signaling receptor activity. Acts upstream of or within negative regulation of interleukin-10 production; negative regulation of interleukin-12 production; and regulation of cell population proliferation. Located in external side of plasma membrane and extracellular space. Is expressed in renal vasculature. Orthologous to human TNFRSF9 (TNF receptor superfamily member 9).
Form : Lyophilized
Molecular Mass : 46.7 kDa
AA Sequence : MGNNCYNVVVIVLLLVGCEKVGAVQNSCDNCQPGTFCRKYNPVCKSCPPSTFSSIGGQPNCNICRVCAGYFRFKKFCSSTHNAECECIEGFHCLGPQCTRCEKDCRPGQELTKQGCKTCSLGTFNDQNGTGVCRPWTNCSLDGRSVLKTGTTEKDVVCGPPVVSFSPSTTISVTPEGGPAFKKTTGAAQEEDACSCRCPQEEEGGGGGYEL
Purity : > 98%
Applications : WB; ELISA; FACS; FC
Stability : This bioreagent is stable at 4 centigrade (short-term) and -70 centigrade(long-term). After reconstitution, sample may be stored at 4 centigrade for 2-7 days and below -18 centigrade for future use.
Storage : At -20 centigrade.
Concentration : 1 mg/mL
Storage Buffer : PBS (pH 7.4-7.5). Sterile-filtered colorless solution.
Reconstitution : Reconstitute in sterile distilled H2O to no less than 100 μg/mL; dilute reconstituted stock further in other aqueous solutions if needed. Please review COA for lot-specific instructions. Final measurements should be determined by the end-user for optimal performance.
Gene Name Tnfrsf9 tumor necrosis factor receptor superfamily, member 9 [ Mus musculus (house mouse) ]
Official Symbol TNFRSF9
Synonyms TNFRSF9; tumor necrosis factor receptor superfamily, member 9; tumor necrosis factor receptor superfamily member 9; CD137 antigen; T-cell antigen 4-1BB; 4-1BB ligand receptor; secreted CD137 antigen; ILA; Ly63; 4-1BB; Cd137; CDw137; AA408498; AI325004; A930040I11Rik;
Gene ID 21942
mRNA Refseq NM_001077508
Protein Refseq NP_001070976
UniProt ID P20334

Not For Human Consumption!

Inquiry

  • Reviews (0)
  • Q&As (0)

Customer Reviews

Write a review

Ask a Question for All TNFRSF9 Products

Required fields are marked with *

My Review for All TNFRSF9 Products

Required fields are marked with *

0
cart-icon