Recombinant Full Length Mouse Transmembrane Protein 237(Tmem237) Protein, His-Tagged
Cat.No. : | RFL36273MF |
Product Overview : | Recombinant Full Length Mouse Transmembrane protein 237(Tmem237) Protein (Q3V0J1) (1-427aa), fused to N-terminal His tag, was expressed in E. coli. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Mus musculus |
Source : | E.coli |
Tag : | His |
Protein Length : | Full Length (1-427) |
Form : | Lyophilized powder |
AA Sequence : | MRDDSGPPLEEDQARPPRALPPVPSAIQVCSSFVENNSRMDQQDDLVGEDDIPLSHPKKK KSRTKSSLATASSEGHAEPVVNRRAEGSEPPAAELKEHPEAPAPRRQKKIRPPPELETSL TERPSSPSLLRNENGIDAEPREEAVIPKPRRKAKKTQPAEPQYASELGVEDEDILTDEQS TLEHHSRFTAPTGVSQPVGKVFVEKSRRFQAADRSELIKTTENIDVSMDVKPSWTTRDVA LSVHRAFRMVGLFSHGFLAGCAVWNTVVIYVLAGDQLSNVSNLLQQYKPLAYPFQSLLYL LLALSTVSAFDRTDFAKISVAIRNFLALEPTALASFLYFTALILSLSQQMTSDRIHLYEP SVNGSLWAAEAEEPILVPWIIVNLVVALLVGLSWLFLSYRPGMDLSEELMFFSDVDEHPE TGTKASP |
Purity : | Greater than 90% as determined by SDS-PAGE. |
Notes : | Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week. |
Storage : | Store at -20°C/-80°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. |
Storage Buffer : | Tris/PBS-based buffer, 6% Trehalose, pH 8.0 |
Reconstitution : | We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20℃/-80℃. Our default final concentration of glycerol is 50%. Customers could use it as reference. |
Gene Name | Tmem237 |
Synonyms | Tmem237; Als2cr4; Transmembrane protein 237; Amyotrophic lateral sclerosis 2 chromosomal region candidate gene 4 protein homolog |
UniProt ID | Q3V0J1 |
◆ Recombinant Proteins | ||
RFL-2260GF | Recombinant Full Length Chicken Transmembrane Protein 237(Tmem237) Protein, His-Tagged | +Inquiry |
RFL-5576BF | Recombinant Full Length Bovine Transmembrane Protein 237(Tmem237) Protein, His-Tagged | +Inquiry |
TMEM237-8544H | Recombinant Human TMEM237 protein, His-tagged | +Inquiry |
RFL36273MF | Recombinant Full Length Mouse Transmembrane Protein 237(Tmem237) Protein, His-Tagged | +Inquiry |
TMEM237-17014M | Recombinant Mouse TMEM237 Protein | +Inquiry |
◆ Cell & Tissue Lysates | ||
TMEM237-8891HCL | Recombinant Human ALS2CR4 293 Cell Lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews (0)
- Q&As (0)
Ask a Question for All Tmem237 Products
Required fields are marked with *
My Review for All Tmem237 Products
Required fields are marked with *