Recombinant Full Length Mouse Transmembrane Protein 95(Tmem95) Protein, His-Tagged
Cat.No. : | RFL36390MF |
Product Overview : | Recombinant Full Length Mouse Transmembrane protein 95(Tmem95) Protein (P0DJF3) (17-176aa), fused to N-terminal His tag, was expressed in E. coli. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Mus musculus |
Source : | E.coli |
Tag : | His |
Protein Length : | Full Length of Mature Protein (17-176) |
Form : | Lyophilized powder |
AA Sequence : | CIFCRLQDHALANRLAQLNNQTKPKWKWKEWASPDFSAFALDEVSMKQVTEKTHRVLRVIEKKGSTSLIPLYWQWLQKTRIPQYTREALCAPVCRGSTILYNCSTCEGKEESCWPQKHCYPDSHDLWDARILLLCIFGIVLLSGVVSLQVEYLNLQAKDL |
Purity : | Greater than 90% as determined by SDS-PAGE. |
Applications : | SDS-PAGE |
Notes : | Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week. |
Storage : | Store at -20°C/-80°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. |
Storage Buffer : | Tris/PBS-based buffer, 6% Trehalose, pH 8.0 |
Reconstitution : | We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20℃/-80℃. Our default final concentration of glycerol is 50%. Customers could use it as reference. |
Gene Name | Tmem95 |
Synonyms | Tmem95; Sperm-egg fusion protein TMEM95; Transmembrane protein 95 |
UniProt ID | P0DJF3 |
◆ Recombinant Proteins | ||
TMEM95-4660R | Recombinant Rhesus Macaque TMEM95 Protein, His (Fc)-Avi-tagged | +Inquiry |
TMEM95-3300H | Recombinant Human TMEM95 protein, His-tagged | +Inquiry |
TMEM95-9439M | Recombinant Mouse TMEM95 Protein, His (Fc)-Avi-tagged | +Inquiry |
TMEM95-4846R | Recombinant Rhesus monkey TMEM95 Protein, His-tagged | +Inquiry |
TMEM95-17096M | Recombinant Mouse TMEM95 Protein | +Inquiry |
◆ Cell & Tissue Lysates | ||
TMEM95-692HCL | Recombinant Human TMEM95 lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews
- Q&As
Ask a Question for All Tmem95 Products
Required fields are marked with *
My Review for All Tmem95 Products
Required fields are marked with *
0
Inquiry Basket