Recombinant Full Length Mouse Tumor Necrosis Factor Ligand Superfamily Member 8(Tnfsf8) Protein, His-Tagged
| Cat.No. : | RFL25423MF |
| Product Overview : | Recombinant Full Length Mouse Tumor necrosis factor ligand superfamily member 8(Tnfsf8) Protein (P32972) (1-239aa), fused to N-terminal His tag, was expressed in E. coli. |
- Specification
- Gene Information
- Related Products
- Download
| Species : | Mouse |
| Source : | E.coli |
| Tag : | His |
| Protein Length : | Full Length (1-239) |
| Form : | Lyophilized powder |
| AA Sequence : | MEPGLQQAGSCGAPSPDPAMQVQPGSVASPWRSTRPWRSTSRSYFYLSTTALVCLVVAVAIILVLVVQKKDSTPNTTEKAPLKGGNCSEDLFCTLKSTPSKKSWAYLQVSKHLNNTKLSWNEDGTIHGLIYQDGNLIVQFPGLYFIVCQLQFLVQCSNHSVDLTLQLLINSKIKKQTLVTVCESGVQSKNIYQNLSQFLLHYLQVNSTISVRVDNFQYVDTNTFPLDNVLSVFLYSSSD |
| Purity : | Greater than 90% as determined by SDS-PAGE. |
| Applications : | SDS-PAGE |
| Notes : | Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week. |
| Storage : | Store at -20°C/-80°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. |
| Storage Buffer : | Tris/PBS-based buffer, 6% Trehalose, pH 8.0 |
| Reconstitution : | We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20℃/-80℃. Our default final concentration of glycerol is 50%. Customers could use it as reference. |
| Gene Name | Tnfsf8 |
| Synonyms | Tnfsf8; Cd30l; Cd30lg; Tumor necrosis factor ligand superfamily member 8; CD30 ligand; CD30-L; CD antigen CD153 |
| UniProt ID | P32972 |
| ◆ Recombinant Proteins | ||
| TNFSF8-19H | Recombinant Human TNFSF8 Protein (K110A), His-tagged | +Inquiry |
| TNFSF8-18H | Recombinant Human TNFSF8 Protein (Y126A), His-tagged | +Inquiry |
| Tnfsf8-10626M | Recombinant Mouse Tnfsf8 Protein, 68-239, C-Fc-Avi tagged | +Inquiry |
| TNFSF8-5340H | Recombinant Human TNFSF8 Protein (Gln63-Asp234), N-Fc tagged | +Inquiry |
| TNFSF8-2258H | Recombinant Human TNFSF8 Protein, MYC/DDK-tagged | +Inquiry |
| ◆ Cell & Tissue Lysates | ||
| TNFSF8-1190CCL | Recombinant Cynomolgus TNFSF8 cell lysate | +Inquiry |
| TNFSF8-1053RCL | Recombinant Rat TNFSF8 cell lysate | +Inquiry |
| TNFSF8-3051HCL | Recombinant Human TNFSF8 cell lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews (0)
- Q&As (0)
Ask a Question for All Tnfsf8 Products
Required fields are marked with *
My Review for All Tnfsf8 Products
Required fields are marked with *
