Recombinant Mouse Tnfsf8 Protein, 68-239, C-Fc-Avi tagged
| Cat.No. : | Tnfsf8-10626M |
| Product Overview : | Recombinant Mouse Tnfsf8 Protein (68-239) with C-Fc-Avi tag was expressed in HEK293. |
| Availability | January 07, 2026 |
| Unit | |
| Price | |
| Qty |
- Specification
- Gene Information
- Related Products
- Download
| Species : | Mouse |
| Source : | HEK293 |
| Tag : | Avi&Fc |
| Protein Length : | 68-239 |
| Description : | Predicted to enable cytokine activity and tumor necrosis factor receptor binding activity. Acts upstream of or within CD8-positive, alpha-beta T cell differentiation; defense response to Gram-positive bacterium; and positive regulation of transcription by RNA polymerase II. Predicted to be located in extracellular space and membrane. Predicted to be integral component of membrane. Orthologous to human TNFSF8 (TNF superfamily member 8). |
| Molecular Mass : | 47 kDa |
| AA Sequence : | QKKDSTPNTTEKAPLKGGNCSEDLFCTLKSTPSKKSWAYLQVSKHLNNTKLSWNEDGTIHGLIYQDGNLIVQFPGLYFIVCQLQFLVQCSNHSVDLTLQLLINSKIKKQTLVTVCESGVQSKNIYQNLSQFLLHYLQVNSTISVRVDNFQYVDTNTFPLDNVLSVFLYSSSDPKSCDKTHTCPPCPAPELLGGPSVFLFPPKPKDTLMISRTPEVTCVVVDVSHEDPEVKFNWYVDGVEVHNAKTKPREEQYNSTYRVVSVLTVLHQDWLNGKEYKCKVSNKALPAPIEKTISKAKGQPREPQVYTLPPSRDELTKNQVSLTCLVKGFYPSDIAVEWESNGQPENNYKTTPPVLDSDGSFFLYSKLTVDKSRWQQGNVFSCSVMHEALHNHYTQKSLSLSPGKGLNDIFEAQKIEWHE |
| Endotoxin : | < 1 EU/μg protein by LAL |
| Purity : | > 85% as determined by SDS-PAGE |
| Storage : | Store it under sterile conditions at -20 to -80 centigrade. It is recommended that the protein be aliquoted for optimal storage. Avoid repeated freeze-thaw cycles. |
| Concentration : | 0.28 mg/mL |
| Storage Buffer : | Sterile PBS, pH7.4 |
| Gene Name | Tnfsf8 tumor necrosis factor (ligand) superfamily, member 8 [ Mus musculus (house mouse) ] |
| Official Symbol | Tnfsf8 |
| Synonyms | TNFSF8; tumor necrosis factor (ligand) superfamily, member 8; tumor necrosis factor ligand superfamily member 8; CD30-L; CD30 ligand; CD153; Cd30l; CD30LG |
| Gene ID | 21949 |
| mRNA Refseq | NM_009403 |
| Protein Refseq | NP_033429 |
| UniProt ID | P32972 |
| ◆ Recombinant Proteins | ||
| TNFSF8-17180M | Recombinant Mouse TNFSF8 Protein | +Inquiry |
| Tnfsf8-10626M | Recombinant Mouse Tnfsf8 Protein, 68-239, C-Fc-Avi tagged | +Inquiry |
| Tnfsf8-2374R | Recombinant Rat Tnfsf8 protein(Gln66-Asp237) | +Inquiry |
| TNFSF8-4502H | Recombinant Human TNFSF8 Protein, His (Fc)-Avi-tagged | +Inquiry |
| TNFSF8-015H | Recombinant Human TNFSF8 Protein, MYC/DDK-tagged, C13 and N15-labeled | +Inquiry |
| ◆ Cell & Tissue Lysates | ||
| TNFSF8-1190CCL | Recombinant Cynomolgus TNFSF8 cell lysate | +Inquiry |
| TNFSF8-1053RCL | Recombinant Rat TNFSF8 cell lysate | +Inquiry |
| TNFSF8-3051HCL | Recombinant Human TNFSF8 cell lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews (0)
- Q&As (0)
Ask a Question for All Tnfsf8 Products
Required fields are marked with *
My Review for All Tnfsf8 Products
Required fields are marked with *
