Recombinant Mouse Tnfsf8 Protein, 68-239, C-Fc-Avi tagged

Cat.No. : Tnfsf8-10626M
Product Overview : Recombinant Mouse Tnfsf8 Protein (68-239) with C-Fc-Avi tag was expressed in HEK293.
Availability April 30, 2025
Unit
Price
Qty
  • Specification
  • Gene Information
  • Related Products
  • Download
Species : Mouse
Source : HEK293
Tag : Avi&Fc
Protein Length : 68-239
Description : Predicted to enable cytokine activity and tumor necrosis factor receptor binding activity. Acts upstream of or within CD8-positive, alpha-beta T cell differentiation; defense response to Gram-positive bacterium; and positive regulation of transcription by RNA polymerase II. Predicted to be located in extracellular space and membrane. Predicted to be integral component of membrane. Orthologous to human TNFSF8 (TNF superfamily member 8).
Molecular Mass : 47 kDa
AA Sequence : QKKDSTPNTTEKAPLKGGNCSEDLFCTLKSTPSKKSWAYLQVSKHLNNTKLSWNEDGTIHGLIYQDGNLIVQFPGLYFIVCQLQFLVQCSNHSVDLTLQLLINSKIKKQTLVTVCESGVQSKNIYQNLSQFLLHYLQVNSTISVRVDNFQYVDTNTFPLDNVLSVFLYSSSDPKSCDKTHTCPPCPAPELLGGPSVFLFPPKPKDTLMISRTPEVTCVVVDVSHEDPEVKFNWYVDGVEVHNAKTKPREEQYNSTYRVVSVLTVLHQDWLNGKEYKCKVSNKALPAPIEKTISKAKGQPREPQVYTLPPSRDELTKNQVSLTCLVKGFYPSDIAVEWESNGQPENNYKTTPPVLDSDGSFFLYSKLTVDKSRWQQGNVFSCSVMHEALHNHYTQKSLSLSPGKGLNDIFEAQKIEWHE
Endotoxin : < 1 EU/μg protein by LAL
Purity : > 85% as determined by SDS-PAGE
Storage : Store it under sterile conditions at -20 to -80 centigrade. It is recommended that the protein be aliquoted for optimal storage. Avoid repeated freeze-thaw cycles.
Concentration : 0.28 mg/mL
Storage Buffer : Sterile PBS, pH7.4
Gene Name Tnfsf8 tumor necrosis factor (ligand) superfamily, member 8 [ Mus musculus (house mouse) ]
Official Symbol Tnfsf8
Synonyms TNFSF8; tumor necrosis factor (ligand) superfamily, member 8; tumor necrosis factor ligand superfamily member 8; CD30-L; CD30 ligand; CD153; Cd30l; CD30LG
Gene ID 21949
mRNA Refseq NM_009403
Protein Refseq NP_033429
UniProt ID P32972

Not For Human Consumption!

Inquiry

  • Reviews
  • Q&As

Customer Reviews (0)

Write a review

Q&As (0)

Ask a question

Ask a Question for All Tnfsf8 Products

Required fields are marked with *

My Review for All Tnfsf8 Products

Required fields are marked with *

0

Inquiry Basket

cartIcon