Recombinant Full Length Mouse Tumor Necrosis Factor Receptor Superfamily Member 5(Cd40) Protein, His-Tagged
| Cat.No. : | RFL13008MF |
| Product Overview : | Recombinant Full Length Mouse Tumor necrosis factor receptor superfamily member 5(Cd40) Protein (P27512) (20-289aa), fused to N-terminal His tag, was expressed in E. coli. |
- Specification
- Gene Information
- Related Products
- Download
| Species : | Mus musculus |
| Source : | E.coli |
| Tag : | His |
| Protein Length : | Full Length of Mature Protein (20-289) |
| Form : | Lyophilized powder |
| AA Sequence : | LGQCVTCSDKQYLHDGQCCDLCQPGSRLTSHCTALEKTQCHPCDSGEFSAQWNREIRCHQHRHCEPNQGLRVKKEGTAESDTVCTCKEGQHCTSKDCEACAQHTPCIPGFGVMEMATETTDTVCHPCPVGFFSNQSSLFEKCYPWTSCEDKNLEVLQKGTSQTNVICGLKSRMRALLVIPVVMGILITIFGVFLYIKKVVKKPKDNEILPPAARRQDPQEMEDYPGHNTAAPVQETLHGCQPVTQEDGKESRISVQERQVTDSIALRPLV |
| Purity : | Greater than 90% as determined by SDS-PAGE. |
| Applications : | SDS-PAGE |
| Notes : | Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week. |
| Storage : | Store at -20°C/-80°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. |
| Storage Buffer : | Tris/PBS-based buffer, 6% Trehalose, pH 8.0 |
| Reconstitution : | We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20℃/-80℃. Our default final concentration of glycerol is 50%. Customers could use it as reference. |
| Gene Name | Cd40 |
| Synonyms | Cd40; Tnfrsf5; Tumor necrosis factor receptor superfamily member 5; B-cell surface antigen CD40; Bp50; CD40L receptor; CD antigen CD40 |
| UniProt ID | P27512 |
| ◆ Recombinant Proteins | ||
| CD40-108HP | Recombinant Human CD40 protein, Fc-tagged, R-PE labeled | +Inquiry |
| CD40-8823CAF488 | Recombinant Monkey CD40 Protein, Fc-tagged, Alexa Fluor 488 conjugated | +Inquiry |
| CD40-165CAF647 | Recombinant Canine CD40 Protein, His-tagged, Alexa Fluor 647 conjugated | +Inquiry |
| Cd40-6892M | Recombinant Mouse Cd40, Fc-His tagged | +Inquiry |
| CD40-8823CAF555 | Recombinant Monkey CD40 Protein, Fc-tagged, Alexa Fluor 555 conjugated | +Inquiry |
| ◆ Cell & Tissue Lysates | ||
| CD40-2617HCL | Recombinant Human CD40 cell lysate | +Inquiry |
| CD40-1262RCL | Recombinant Rat CD40 cell lysate | +Inquiry |
| CD40-001CCL | Recombinant Canine CD40 cell lysate | +Inquiry |
| CD40-1254CCL | Recombinant Cynomolgus CD40 cell lysate | +Inquiry |
| CD40-1831MCL | Recombinant Mouse CD40 cell lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews (0)
- Q&As (0)
Ask a Question for All Cd40 Products
Required fields are marked with *
My Review for All Cd40 Products
Required fields are marked with *
