Recombinant Full Length Mouse V-Type Proton Atpase Subunit S1(Atp6Ap1) Protein, His-Tagged
Cat.No. : | RFL12719MF |
Product Overview : | Recombinant Full Length Mouse V-type proton ATPase subunit S1(Atp6ap1) Protein (Q9R1Q9) (33-463aa), fused to N-terminal His tag, was expressed in E. coli. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Mus musculus |
Source : | E.coli |
Tag : | His |
Protein Length : | Full Length of Mature Protein (33-463) |
Form : | Lyophilized powder |
AA Sequence : | VATEQQVPLVLWSSDRNLWAPVADTHEGHITSDMQLSTYLDPALELGPRNVLLFLQDKLS IEDFTAYGGVFGNKQDSAFSNLENALDLAPSSLVLPAVDWYAISTLTTYLQEKLGASPLH VDLATLKELKLNASLPALLLIRLPYTASSGLMAPREVLTGNDEVIGQVLSTLKSEDVPYT AALTAVRPSRVARDITMVAGGLGRQLLQTQVASPAIHPPVSYNDTAPRILFWAQNFSVAY KDEWKDLTSLTFGVENLNLTGSFWNDSFAMLSLTYEPLFGATVTFKFILASRFYPVSARY WFAMERLEIHSNGSVAHFNVSQVTGPSIYSFHCEYVSSVSKKGNLLVTNVPSVWQMTLHN FQIQAFNVTGEQFSYASDCAGFFSPGIWMGLLTTLFMLFIFTYGLHMILSLKTMDRFDDH KGPTITLTQIV |
Purity : | Greater than 90% as determined by SDS-PAGE. |
Notes : | Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week. |
Storage : | Store at -20°C/-80°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. |
Storage Buffer : | Tris/PBS-based buffer, 6% Trehalose, pH 8.0 |
Reconstitution : | We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20℃/-80℃. Our default final concentration of glycerol is 50%. Customers could use it as reference. |
Gene Name | Atp6ap1 |
Synonyms | Atp6ap1; Atp6ip1; Atp6s1; V-type proton ATPase subunit S1; V-ATPase subunit S1; Protein C7-1; V-ATPase Ac45 subunit; V-ATPase S1 accessory protein; Vacuolar proton pump subunit S1 |
UniProt ID | Q9R1Q9 |
◆ Recombinant Proteins | ||
RFL12719MF | Recombinant Full Length Mouse V-Type Proton Atpase Subunit S1(Atp6Ap1) Protein, His-Tagged | +Inquiry |
ATP6AP1-4576C | Recombinant Chicken ATP6AP1 | +Inquiry |
ATP6AP1-1542HF | Recombinant Full Length Human ATP6AP1 Protein, GST-tagged | +Inquiry |
ATP6AP1-539R | Recombinant Rat ATP6AP1 Protein, His (Fc)-Avi-tagged | +Inquiry |
ATP6AP1-992H | Recombinant Human ATP6AP1 protein, GST-tagged | +Inquiry |
◆ Cell & Tissue Lysates | ||
ATP6AP1-8592HCL | Recombinant Human ATP6AP1 293 Cell Lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews
- Q&As
Ask a Question for All Atp6ap1 Products
Required fields are marked with *
My Review for All Atp6ap1 Products
Required fields are marked with *
0
Inquiry Basket