Recombinant Full Length Mouse Vesicle-Associated Membrane Protein 2(Vamp2) Protein, His-Tagged
| Cat.No. : | RFL7087MF |
| Product Overview : | Recombinant Full Length Mouse Vesicle-associated membrane protein 2(Vamp2) Protein (P63044) (2-116aa), fused to N-terminal His tag, was expressed in E. coli. |
- Specification
- Gene Information
- Related Products
- Download
| Species : | Mouse |
| Source : | E.coli |
| Tag : | His |
| Protein Length : | Full Length of Mature Protein (2-116) |
| Form : | Lyophilized powder |
| AA Sequence : | SATAATVPPAAPAGEGGPPAPPPNLTSNRRLQQTQAQVDEVVDIMRVNVDKVLERDQKLSELDDRADALQAGASQFETSAAKLKRKYWWKNLKMMIILGVICAIILIIIIVYFST |
| Purity : | Greater than 90% as determined by SDS-PAGE. |
| Applications : | SDS-PAGE |
| Notes : | Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week. |
| Storage : | Store at -20°C/-80°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. |
| Storage Buffer : | Tris/PBS-based buffer, 6% Trehalose, pH 8.0 |
| Reconstitution : | We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20℃/-80℃. Our default final concentration of glycerol is 50%. Customers could use it as reference. |
| Gene Name | Vamp2 |
| Synonyms | Vamp2; Syb2; Vesicle-associated membrane protein 2; VAMP-2; Synaptobrevin-2 |
| UniProt ID | P63044 |
| ◆ Recombinant Proteins | ||
| VAMP2-544H | Recombinant Human VAMP2 Protein, His&GST-tagged | +Inquiry |
| VAMP2-4954R | Recombinant Rhesus Macaque VAMP2 Protein, His (Fc)-Avi-tagged | +Inquiry |
| VAMP2-216H | Recombinant Human VAMP2 Protein, His Tagged | +Inquiry |
| VAMP2-5141R | Recombinant Rhesus monkey VAMP2 Protein, His-tagged | +Inquiry |
| VAMP2-9990M | Recombinant Mouse VAMP2 Protein, His (Fc)-Avi-tagged | +Inquiry |
| ◆ Cell & Tissue Lysates | ||
| VAMP2-438HCL | Recombinant Human VAMP2 293 Cell Lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews (0)
- Q&As (0)
Ask a Question for All Vamp2 Products
Required fields are marked with *
My Review for All Vamp2 Products
Required fields are marked with *




