Recombinant Human VAMP2 Protein, His Tagged

Cat.No. : VAMP2-216H
Product Overview : Recombinant Human VAMP2 protein (1-89 aa) with His tag was expressed in E. coli.
Availability October 10, 2025
Unit
Price
Qty
  • Specification
  • Gene Information
  • Related Products
  • Download
Species : Human
Source : E.coli
Tag : His
Protein Length : 1-89 aa
Description : The protein encoded by this gene is a member of the vesicle-associated membrane protein (VAMP)/synaptobrevin family. Synaptobrevins/VAMPs, syntaxins, and the 25-kD synaptosomal-associated protein SNAP25 are the main components of a protein complex involved in the docking and/or fusion of synaptic vesicles with the presynaptic membrane. This gene is thought to participate in neurotransmitter release at a step between docking and fusion. The protein forms a stable complex with syntaxin, synaptosomal-associated protein, 25 kD, and synaptotagmin. It also forms a distinct complex with synaptophysin. It is a likely candidate gene for familial infantile myasthenia (FIMG) because of its map location and because it encodes a synaptic vesicle protein of the type that has been implicated in the pathogenesis of FIMG.
Molecular Mass : 14 kDa
AA Sequence : MRGSHHHHHHGMASMTGGQQMGRDLYDDDDKDRWGSHMSATAATAPPAAPAGEGGPPAPPPNLTSNRRLQQTQAQVDEVVDIMRVNVDKVLERDQKLSELDDRADALQAGASQFETSAAKLKRKYW
Endotoxin : < 1 EU/μg by LAL.
Purity : > 90 % by SDS-PAGE
Storage : Store it under sterile conditions at -20 to -80 centigrade. It is recommended that the protein be aliquoted for optimal storage. Avoid repeated freeze-thaw cycles.
Storage Buffer : Sterile PBS, pH7.4
Concentration : 1 mg/mL by BCA
Gene Name VAMP2 vesicle associated membrane protein 2 [ Homo sapiens (human) ]
Official Symbol VAMP2
Synonyms VAMP2; vesicle-associated membrane protein 2 (synaptobrevin 2); SYB2; vesicle-associated membrane protein 2; VAMP 2; synaptobrevin 2; synaptobrevin-2; vesicle associated membrane protein 2; VAMP-2; FLJ11460;
Gene ID 6844
mRNA Refseq NM_014232
Protein Refseq NP_055047
MIM 185881
UniProt ID P63027

Not For Human Consumption!

Inquiry

  • Reviews (0)
  • Q&As (0)

Customer Reviews

Write a review

Ask a Question for All VAMP2 Products

Required fields are marked with *

My Review for All VAMP2 Products

Required fields are marked with *

0
cart-icon
0
compare icon