Recombinant Human VAMP2 Protein, His Tagged
| Cat.No. : | VAMP2-216H |
| Product Overview : | Recombinant Human VAMP2 protein (1-89 aa) with His tag was expressed in E. coli. |
| Availability | February 01, 2026 |
| Unit | |
| Price | |
| Qty |
- Specification
- Gene Information
- Related Products
- Download
| Species : | Human |
| Source : | E.coli |
| Tag : | His |
| Protein Length : | 1-89 aa |
| Description : | The protein encoded by this gene is a member of the vesicle-associated membrane protein (VAMP)/synaptobrevin family. Synaptobrevins/VAMPs, syntaxins, and the 25-kD synaptosomal-associated protein SNAP25 are the main components of a protein complex involved in the docking and/or fusion of synaptic vesicles with the presynaptic membrane. This gene is thought to participate in neurotransmitter release at a step between docking and fusion. The protein forms a stable complex with syntaxin, synaptosomal-associated protein, 25 kD, and synaptotagmin. It also forms a distinct complex with synaptophysin. It is a likely candidate gene for familial infantile myasthenia (FIMG) because of its map location and because it encodes a synaptic vesicle protein of the type that has been implicated in the pathogenesis of FIMG. |
| Molecular Mass : | 14 kDa |
| AA Sequence : | MRGSHHHHHHGMASMTGGQQMGRDLYDDDDKDRWGSHMSATAATAPPAAPAGEGGPPAPPPNLTSNRRLQQTQAQVDEVVDIMRVNVDKVLERDQKLSELDDRADALQAGASQFETSAAKLKRKYW |
| Endotoxin : | < 1 EU/μg by LAL. |
| Purity : | > 90 % by SDS-PAGE |
| Storage : | Store it under sterile conditions at -20 to -80 centigrade. It is recommended that the protein be aliquoted for optimal storage. Avoid repeated freeze-thaw cycles. |
| Storage Buffer : | Sterile PBS, pH7.4 |
| Concentration : | 1 mg/mL by BCA |
| Gene Name | VAMP2 vesicle associated membrane protein 2 [ Homo sapiens (human) ] |
| Official Symbol | VAMP2 |
| Synonyms | VAMP2; vesicle-associated membrane protein 2 (synaptobrevin 2); SYB2; vesicle-associated membrane protein 2; VAMP 2; synaptobrevin 2; synaptobrevin-2; vesicle associated membrane protein 2; VAMP-2; FLJ11460; |
| Gene ID | 6844 |
| mRNA Refseq | NM_014232 |
| Protein Refseq | NP_055047 |
| MIM | 185881 |
| UniProt ID | P63027 |
| ◆ Cell & Tissue Lysates | ||
| VAMP2-438HCL | Recombinant Human VAMP2 293 Cell Lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews (0)
- Q&As (0)
Ask a Question for All VAMP2 Products
Required fields are marked with *
My Review for All VAMP2 Products
Required fields are marked with *
