Recombinant Full Length Mouse Zinc Transporter Zip5(Slc39A5) Protein, His-Tagged
Cat.No. : | RFL19670MF |
Product Overview : | Recombinant Full Length Mouse Zinc transporter ZIP5(Slc39a5) Protein (Q9D856) (20-535aa), fused to N-terminal His tag, was expressed in E. coli. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Mus musculus |
Source : | E.coli |
Tag : | His |
Protein Length : | Full Length of Mature Protein (20-535) |
Form : | Lyophilized powder |
AA Sequence : | WVGGSVPNLGPAEQEQNHYLAQLFGLYGENGTLTAGGLARLLHSLGLGRVQGLRLGHHEP PTGRAAPTSGDNFTHRLQEPELSVDIWAGMPLGPSGWGDQEESKAPDLHGSGPSSLDLFQ RLLLLDHSLADHLNEDCLNGSQLLVNFGLSPVAPLTPRQFALLCPALLYQIDSRVCIKTP APAPPGDVLSALLHSGLAVLFLSLPAPLSLLLLRLLGPRLLRPVLGFLGALAVGTLCGDA LLHLLPHAQGGRHTGPSEQSEEDLGPGLSVLGGLFLLFMLENTLGLVRHRGLRPRCCRNK RDLGEPNPDPEDGSGMVLRPLQAASEPEVQGQRENRQSSPSLAPPGHQGHSHEHRGGSIA WMVLLGDCLHNLTDGLALGAAFSDGFSSGLSTTLAVFCHELPHELGDFAMLLQEGLSFRK LLLLSLVSGALGLGGAALGVGLSLGPVPLTPWVFGTTAGVFLYVALVDMLPTLLRPPEPL PVFHVLLQGLGLLLGGSLMFTIALLEEQLVPTVPDG |
Purity : | Greater than 90% as determined by SDS-PAGE. |
Notes : | Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week. |
Storage : | Store at -20°C/-80°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. |
Storage Buffer : | Tris/PBS-based buffer, 6% Trehalose, pH 8.0 |
Reconstitution : | We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20℃/-80℃. Our default final concentration of glycerol is 50%. Customers could use it as reference. |
Gene Name | Slc39a5 |
Synonyms | Slc39a5; Zip5; Zinc transporter ZIP5; Solute carrier family 39 member 5; Zrt- and Irt-like protein 5; ZIP-5 |
UniProt ID | Q9D856 |
◆ Recombinant Proteins | ||
RFL19670MF | Recombinant Full Length Mouse Zinc Transporter Zip5(Slc39A5) Protein, His-Tagged | +Inquiry |
RFL15879HF | Recombinant Full Length Human Zinc Transporter Zip5(Slc39A5) Protein, His-Tagged | +Inquiry |
SLC39A5-8367M | Recombinant Mouse SLC39A5 Protein, His (Fc)-Avi-tagged | +Inquiry |
SLC39A5-2765H | Recombinant Human SLC39A5, His-tagged | +Inquiry |
SLC39A5-6805HF | Recombinant Full Length Human SLC39A5 Protein, GST-tagged | +Inquiry |
◆ Cell & Tissue Lysates | ||
SLC39A5-1718HCL | Recombinant Human SLC39A5 293 Cell Lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews (0)
- Q&As (0)
Ask a Question for All Slc39a5 Products
Required fields are marked with *
My Review for All Slc39a5 Products
Required fields are marked with *
0
Inquiry Basket