Recombinant Human SLC39A5 Protein, GST-tagged

• Cat.No.: SLC39A5-659H
• Product Overview: Recombinant Human SLC39A5 Full-Length ORF Protein (21-539 aa) is produced by Wheat Germ (in vitro) expression system. This protein is fused with a GST tag at the N-terminal.

Specification

• Species: Human
• Source: Wheat Germ
• Tag: GST
• Protein Length: 21-539 aa
• Description: Zinc is an essential cofactor for hundreds of enzymes. It is involved in protein, nucleic acid, carbohydrate, and lipid metabolism, as well as in the control of gene transcription, growth, development, and differentiation. SLC39A5 belongs to a subfamily of proteins that show structural characteristics of zinc transporters.
• Form: 50 mM Tris-HCI, 10 mM reduced Glutathione, pH=8.0 in the elution buffer.
• Molecular Mass: 82.83 kDa
• AA Sequence: VGGSVPNLGPAEQEQNHYLAQLFGLYGENGTLTAGGLARLLHSLGLGRVQGLRLGQHGPLTGRAASPAADNSTHRPQNPELSVDVWAGMPLGPSGWGDLEESKAPHLPRGPAPSGLDLLHRLLLLDHSLADHLNEDCLNGSQLLVNFGLSPAAPLTPRQFALLCPALLYQIDSRVCIGAPAPAPPGDLLSALLQSALAVLLLSLPSPLSLLLLRLLGPRLLRPLLGFLGALAVGTLCGDALLHLLPHAQEGRHAGPGGLPEKDLGPGLSVLGGLFLLFVLENMLGLLRHRGLRPRCCRRKRRNLETRNLDPENGSGMALQPLQAAPEPGAQGQREKNSQHPPALAPPGHQGHSHGHQGGTDITWMVLLGDGLHNLTDGLAIGAAFSDGFSSGLSTTLAVFCHELPHELGDFAMLLQSGLSFRRLLLLSLVSGALGLGGAVLGVGLSLGPVPLTPWVFGVTAGVFLYVALVDMLPALLRPPEPLPTPHVLLQGLGLLLGGGLMLAITLLEERLLPVTTEG
• Applications: Enzyme-linked Immunoabsorbent Assay; Western Blot (Recombinant protein); Antibody Production; Protein Array
• Notes: Best use within three months from the date of receipt of this protein
• Storage: Store at -80 centigrade. Aliquot to avoid repeated freezing and thawing.

Gene Information

• Gene Name: SLC39A5 solute carrier family 39 (metal ion transporter), member 5 [ Homo sapiens ]
• Official Symbol: SLC39A5
• Synonyms: SLC39A5; ZIP-5; ZIP5; LZT-Hs7; MGC34778
• Gene ID: 283375
• mRNA Refseq: NM_001135195
• Protein Refseq: NP_001128667
• MIM: 608730
• UniProt ID: Q6ZMH5