Recombinant Human SLC39A5 Protein, GST-tagged
Cat.No. : | SLC39A5-659H |
Product Overview : | Recombinant Human SLC39A5 Full-Length ORF Protein (21-539 aa) is produced by Wheat Germ (in vitro) expression system. This protein is fused with a GST tag at the N-terminal. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Human |
Source : | Wheat Germ |
Tag : | GST |
Protein Length : | 21-539 aa |
Description : | Zinc is an essential cofactor for hundreds of enzymes. It is involved in protein, nucleic acid, carbohydrate, and lipid metabolism, as well as in the control of gene transcription, growth, development, and differentiation. SLC39A5 belongs to a subfamily of proteins that show structural characteristics of zinc transporters. |
Form : | 50 mM Tris-HCI, 10 mM reduced Glutathione, pH=8.0 in the elution buffer. |
Molecular Mass : | 82.83 kDa |
AA Sequence : | VGGSVPNLGPAEQEQNHYLAQLFGLYGENGTLTAGGLARLLHSLGLGRVQGLRLGQHGPLTGRAASPAADNSTHRPQNPELSVDVWAGMPLGPSGWGDLEESKAPHLPRGPAPSGLDLLHRLLLLDHSLADHLNEDCLNGSQLLVNFGLSPAAPLTPRQFALLCPALLYQIDSRVCIGAPAPAPPGDLLSALLQSALAVLLLSLPSPLSLLLLRLLGPRLLRPLLGFLGALAVGTLCGDALLHLLPHAQEGRHAGPGGLPEKDLGPGLSVLGGLFLLFVLENMLGLLRHRGLRPRCCRRKRRNLETRNLDPENGSGMALQPLQAAPEPGAQGQREKNSQHPPALAPPGHQGHSHGHQGGTDITWMVLLGDGLHNLTDGLAIGAAFSDGFSSGLSTTLAVFCHELPHELGDFAMLLQSGLSFRRLLLLSLVSGALGLGGAVLGVGLSLGPVPLTPWVFGVTAGVFLYVALVDMLPALLRPPEPLPTPHVLLQGLGLLLGGGLMLAITLLEERLLPVTTEG |
Applications : | Enzyme-linked Immunoabsorbent Assay; Western Blot (Recombinant protein); Antibody Production; Protein Array |
Notes : | Best use within three months from the date of receipt of this protein |
Storage : | Store at -80 centigrade. Aliquot to avoid repeated freezing and thawing. |
Gene Name | SLC39A5 solute carrier family 39 (metal ion transporter), member 5 [ Homo sapiens ] |
Official Symbol | SLC39A5 |
Synonyms | SLC39A5; ZIP-5; ZIP5; LZT-Hs7; MGC34778; |
Gene ID | 283375 |
mRNA Refseq | NM_001135195 |
Protein Refseq | NP_001128667 |
MIM | 608730 |
UniProt ID | Q6ZMH5 |
◆ Recombinant Proteins | ||
SLC39A5-15438M | Recombinant Mouse SLC39A5 Protein | +Inquiry |
SLC39A5-6805HF | Recombinant Full Length Human SLC39A5 Protein, GST-tagged | +Inquiry |
SLC39A5-659H | Recombinant Human SLC39A5 Protein, GST-tagged | +Inquiry |
RFL19670MF | Recombinant Full Length Mouse Zinc Transporter Zip5(Slc39A5) Protein, His-Tagged | +Inquiry |
SLC39A5-8367M | Recombinant Mouse SLC39A5 Protein, His (Fc)-Avi-tagged | +Inquiry |
◆ Cell & Tissue Lysates | ||
SLC39A5-1718HCL | Recombinant Human SLC39A5 293 Cell Lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews (0)
- Q&As (0)
Ask a Question for All SLC39A5 Products
Required fields are marked with *
My Review for All SLC39A5 Products
Required fields are marked with *