Creative BioMart to Present at
                        BIO-Europe Spring Creative BioMart to Present at IMMUNOLOGY2024™|May 3-7, 2024|Booth #512

Recombinant Human NDUFB6

Cat.No. : NDUFB6-29478TH
Product Overview : Recombinant fragment of Human NDUFB6 with a N terminal proprietary tag; Predicted MWt 39.82 kDa.
  • Specification
  • Gene Information
  • Related Products
Description : The protein encoded by this gene is a subunit of the multisubunit NADH:ubiquinone oxidoreductase (complex I). Mammalian complex I is composed of 45 different subunits. It locates at the mitochondrial inner membrane. This protein has NADH dehydrogenase activity and oxidoreductase activity. It transfers electrons from NADH to the respiratory chain. The immediate electron acceptor for the enzyme is believed to be ubiquinone. Alternative splicing occurs at this locus and three transcript variants encoding distinct isoforms have been identified.
Protein length : 128 amino acids
Molecular Weight : 39.820kDa inclusive of tags
Source : Wheat germ
Form : Liquid
Purity : Proprietary Purification
Storage buffer : pH: 8.00Constituents:0.79% Tris HCl, 0.3% Glutathione
Storage : Shipped on dry ice. Upon delivery aliquot and store at -80oC. Avoid freeze / thaw cycles.
Sequences of amino acids : MTGYTPDEKLRLQQLRELRRRWLKDQELSPREPVLPPQKM GPMEKFWNKFLENKSPWRKMVHGVYKKSIFVFTHVLVPVW IIHYYMKYHVSEKPYGIVEKKSRIFPGDTILETGEVIPPM KEFPDQHH
Sequence Similarities : Belongs to the complex I NDUFB6 subunit family.
Gene Name : NDUFB6 NADH dehydrogenase (ubiquinone) 1 beta subcomplex, 6, 17kDa [ Homo sapiens ]
Official Symbol : NDUFB6
Synonyms : NDUFB6; NADH dehydrogenase (ubiquinone) 1 beta subcomplex, 6, 17kDa; NADH dehydrogenase (ubiquinone) 1 beta subcomplex, 6 (17kD, B17); NADH dehydrogenase [ubiquinone] 1 beta subcomplex subunit 6; B17; CI; complex I; mitochondrial respiratory chain; B17 su
Gene ID : 4712
mRNA Refseq : NM_001199987
Protein Refseq : NP_001186916
MIM : 603322
Uniprot ID : O95139
Chromosome Location : 9p13.2
Pathway : Alzheimers disease, organism-specific biosystem; Alzheimers disease, conserved biosystem; Electron Transport Chain, organism-specific biosystem; Huntingtons disease, organism-specific biosystem; Huntingtons disease, conserved biosystem;
Function : NADH dehydrogenase (ubiquinone) activity;

For Research Use Only. Not intended for any clinical use. No products from Creative BioMart may be resold, modified for resale or used to manufacture commercial products without prior written approval from Creative BioMart.

Inquiry

0

Inquiry Basket

cartIcon
logo

FOLLOW US

Terms and Conditions        Privacy Policy

Copyright © 2024 Creative BioMart. All Rights Reserved.

Contact Us

  • /

Stay Updated on the Latest Bioscience Trends