Recombinant Full Length Pan Troglodytes Nadh Dehydrogenase [Ubiquinone] 1 Beta Subcomplex Subunit 8, Mitochondrial(Ndufb8) Protein, His-Tagged

Cat.No. : RFL18060PF
Product Overview : Recombinant Full Length Pan troglodytes NADH dehydrogenase [ubiquinone] 1 beta subcomplex subunit 8, mitochondrial(NDUFB8) Protein (Q0MQE7) (29-186aa), fused to N-terminal His tag, was expressed in E. coli.
  • Specification
  • Gene Information
  • Related Products
  • Download
Species : Pan troglodytes
Source : E.coli
Tag : His
Protein Length : Full Length of Mature Protein (29-186)
Form : Lyophilized powder
AA Sequence : ASHMTKDMFPGPYPRTPEERAAAAKKYNMRVEDYEPYPDDGMGYGDYPKLPDRSQHERDP WYSWDQPGLRLNWGEPMHWHLDMYNRNRVDTSPTPLSWHVMCMQLFGFLAFMIFMCWVGD VYPVYQPVGPKQYPYNNLYLERGGDPSKEPERVVHYEI
Purity : Greater than 90% as determined by SDS-PAGE.
Notes : Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week.
Storage : Store at -20°C/-80°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles.
Storage Buffer : Tris/PBS-based buffer, 6% Trehalose, pH 8.0
Reconstitution : We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20℃/-80℃. Our default final concentration of glycerol is 50%. Customers could use it as reference.
Gene Name NDUFB8
Synonyms NDUFB8; NADH dehydrogenase [ubiquinone] 1 beta subcomplex subunit 8, mitochondrial; Complex I-ASHI; CI-ASHI; NADH-ubiquinone oxidoreductase ASHI subunit
UniProt ID Q0MQE7

Not For Human Consumption!

Inquiry

  • Reviews (0)
  • Q&As (0)

Customer Reviews

Write a review

Ask a Question for All NDUFB8 Products

Required fields are marked with *

My Review for All NDUFB8 Products

Required fields are marked with *

0

Inquiry Basket

cartIcon