Recombinant Full Length Pan Troglodytes Tyro Protein Tyrosine Kinase-Binding Protein(Tyrobp) Protein, His-Tagged
Cat.No. : | RFL22251PF |
Product Overview : | Recombinant Full Length Pan troglodytes TYRO protein tyrosine kinase-binding protein(TYROBP) Protein (A4F4L0) (28-113aa), fused to N-terminal His tag, was expressed in E. coli. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Pan troglodytes |
Source : | E.coli |
Tag : | His |
Protein Length : | Full Length of Mature Protein (28-113) |
Form : | Lyophilized powder |
AA Sequence : | QAQSDCSCSTVSPGVLAGIVMGDLVLTVLIALAVYFLGRLVHRGRGAAEAATRKQRITETESPYQELQGQRSDVYSDLNMQRPYYK |
Purity : | Greater than 90% as determined by SDS-PAGE. |
Applications : | SDS-PAGE |
Notes : | Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week. |
Storage : | Store at -20°C/-80°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. |
Storage Buffer : | Tris/PBS-based buffer, 6% Trehalose, pH 8.0 |
Reconstitution : | We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20℃/-80℃. Our default final concentration of glycerol is 50%. Customers could use it as reference. |
Gene Name | TYROBP |
Synonyms | TYROBP; DAP12; TYRO protein tyrosine kinase-binding protein; DNAX-activation protein 12 |
UniProt ID | A4F4L0 |
◆ Recombinant Proteins | ||
TYROBP-6039R | Recombinant Rat TYROBP Protein, His (Fc)-Avi-tagged | +Inquiry |
TYROBP-1569HFL | Recombinant Full Length Human TYROBP Protein, C-Flag-tagged | +Inquiry |
RFL7785HF | Recombinant Full Length Human Tyro Protein Tyrosine Kinase-Binding Protein(Tyrobp) Protein, His-Tagged | +Inquiry |
TYROBP-2287H | Recombinant Human TYROBP Protein, His (Fc)-Avi-tagged | +Inquiry |
TYROBP-520H | Recombinant Human TYROBP Protein, SUMO&His-tagged | +Inquiry |
◆ Cell & Tissue Lysates | ||
TYROBP-614HCL | Recombinant Human TYROBP 293 Cell Lysate | +Inquiry |
TYROBP-613HCL | Recombinant Human TYROBP 293 Cell Lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews (0)
- Q&As (0)
Ask a Question for All TYROBP Products
Required fields are marked with *
My Review for All TYROBP Products
Required fields are marked with *
0
Inquiry Basket