Recombinant Human TYROBP Protein, Myc/DDK-tagged, C13 and N15-labeled

Cat.No. : TYROBP-4167H
Product Overview : TYROBP MS Standard C13 and N15-labeled recombinant protein (NP_003323) with a C-terminal MYC/DDK tag, was expressed in HEK293 cells.
  • Specification
  • Gene Information
  • Related Products
  • Download
Species : Human
Source : HEK293
Tag : DDK&Myc
Description : This gene encodes a transmembrane signaling polypeptide which contains an immunoreceptor tyrosine-based activation motif (ITAM) in its cytoplasmic domain. The encoded protein may associate with the killer-cell inhibitory receptor (KIR) family of membrane glycoproteins and may act as an activating signal transduction element. This protein may bind zeta-chain (TCR) associated protein kinase 70kDa (ZAP-70) and spleen tyrosine kinase (SYK) and play a role in signal transduction, bone modeling, brain myelination, and inflammation. Mutations within this gene have been associated with polycystic lipomembranous osteodysplasia with sclerosing leukoencephalopathy (PLOSL), also known as Nasu-Hakola disease. Its putative receptor, triggering receptor expressed on myeloid cells 2 (TREM2), also causes PLOSL. Multiple alternative transcript variants encoding distinct isoforms have been identified for this gene.
Molecular Mass : 12.2 kDa
AA Sequence : MGGLEPCSRLLLLPLLLAVSGLRPVQAQAQSDCSCSTVSPGVLAGIVMGDLVLTVLIALAVYFLGRLVPRGRGAAEAATRKQRITETESPYQELQGQRSDVYSDLNTQRPYYKTRTRPLEQKLISEEDLAANDILDYKDDDDKV
Purity : > 80% as determined by SDS-PAGE and Coomassie blue staining
Stability : Stable for 3 months from receipt of products under proper storage and handling conditions.
Storage : Store at -80 centigrade. Avoid repeated freeze-thaw cycles.
Concentration : 50 μg/mL as determined by BCA
Storage Buffer : 100 mM glycine, 25 mM Tris-HCl, pH 7.3.
Gene Name TYROBP TYRO protein tyrosine kinase binding protein [ Homo sapiens (human) ]
Official Symbol TYROBP
Synonyms TYROBP; TYRO protein tyrosine kinase binding protein; PLOSL; TYRO protein tyrosine kinase-binding protein; DAP12; DNAX activation protein 12; KARAP; killer activating receptor associated protein; PLO SL; KAR-associated protein; DNAX-activation protein 12; killer-activating receptor-associated protein;
Gene ID 7305
mRNA Refseq NM_003332
Protein Refseq NP_003323
MIM 604142
UniProt ID O43914

Not For Human Consumption!

Inquiry

  • Reviews (0)
  • Q&As (0)

Customer Reviews

Write a review

Ask a Question for All TYROBP Products

Required fields are marked with *

My Review for All TYROBP Products

Required fields are marked with *

0
cart-icon
0
compare icon