Recombinant Full Length Pig Bestrophin-1(Best1) Protein, His-Tagged
Cat.No. : | RFL31245SF |
Product Overview : | Recombinant Full Length Pig Bestrophin-1(BEST1) Protein (Q8WMR7) (1-428aa), fused to N-terminal His tag, was expressed in E. coli. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Sus scrofa (Pig) |
Source : | E.coli |
Tag : | His |
Protein Length : | Full Length (1-428) |
Form : | Lyophilized powder |
AA Sequence : | PQHLVKAGFMTPSEHKHLEKLSLPHNSFWMPWVWFANLSTKAWIGGRIRDPVLLQSLLDE MNTLRTQCGHLYAYDWISVPLVYTQVVTVAVYSFFLACLVGRQFLNPAKAYPGHEMDLVV PLFTFLQFFFYAGWLKVAEQLINPFGEDDDDFETNWIVDRSLQVSLSAVDEMHHDLPPME RDMYWNDPEPHPPYTAASAQSRRPSFFGSTFNISLGKEDMEFQPEEEEEAHTGILGHFLG LQSSDHQPPRTNSKTKLLWPKKEGHFHEGHPKNLRGARLDSSDQEDSKAWREGGFKSAAL CGRPGYHSAPQTPLGHTPMVFPPEESAPLGLRRVSGIDEAAKDQSLQPATPSIKKSFELL PESAEASAEPLQGSHVRRKTVEFNLADLSEAPEHLKEPNLEPPMGIHAILKDHRDPYWAL ENRDEAHS |
Purity : | Greater than 90% as determined by SDS-PAGE. |
Notes : | Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week. |
Storage : | Store at -20°C/-80°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. |
Storage Buffer : | Tris/PBS-based buffer, 6% Trehalose, pH 8.0 |
Reconstitution : | We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20℃/-80℃. Our default final concentration of glycerol is 50%. Customers could use it as reference. |
Gene Name | BEST1 |
Synonyms | BEST1; VMD2; Bestrophin-1; Vitelliform macular dystrophy protein 2 homolog; Fragment |
UniProt ID | Q8WMR7 |
◆ Recombinant Proteins | ||
BEST1-1573HF | Recombinant Full Length Human BEST1 Protein, GST-tagged | +Inquiry |
RFL2382HF | Recombinant Full Length Human Bestrophin-1(Best1) Protein, His-Tagged | +Inquiry |
BEST1-10208H | Recombinant Human BEST1, GST-tagged | +Inquiry |
BEST1-90C | Recombinant Cynomolgus Monkey BEST1 Protein, His (Fc)-Avi-tagged | +Inquiry |
RFL30674MF | Recombinant Full Length Macaca Fascicularis Bestrophin-1(Best1) Protein, His-Tagged | +Inquiry |
◆ Cell & Tissue Lysates | ||
BEST1-1910HCL | Recombinant Human BEST1 cell lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews
- Q&As
Ask a Question for All BEST1 Products
Required fields are marked with *
My Review for All BEST1 Products
Required fields are marked with *
0
Inquiry Basket