Recombinant Full Length Pig Enteropeptidase(Tmprss15) Protein, His-Tagged
Cat.No. : | RFL3711SF |
Product Overview : | Recombinant Full Length Pig Enteropeptidase(TMPRSS15) Protein (P98074) (52-117aa), fused to N-terminal His tag, was expressed in E. coli. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Sus scrofa (Pig) |
Source : | E.coli |
Tag : | His |
Protein Length : | Full Length of Mature Protein (52-117) |
Form : | Lyophilized powder |
AA Sequence : | LGKSHEARGTMKITSGVTYNPNLQDKLSVDFKVLAFDIQQMIGEIFQSSNLKNEYKNSRVLQFENGSVIVIFDLLFAQWVSDENIKEELIQGIEANKSSQLVAFHIDVNSIDITESL |
Purity : | Greater than 90% as determined by SDS-PAGE. |
Applications : | SDS-PAGE |
Notes : | Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week. |
Storage : | Store at -20°C/-80°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. |
Storage Buffer : | Tris/PBS-based buffer, 6% Trehalose, pH 8.0 |
Reconstitution : | We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20℃/-80℃. Our default final concentration of glycerol is 50%. Customers could use it as reference. |
Gene Name | TMPRSS15 |
Synonyms | TMPRSS15; ENTK; PRSS7; Enteropeptidase; Enterokinase; Serine protease 7; Transmembrane protease serine 15 |
UniProt ID | P98074 |
◆ Recombinant Proteins | ||
RFL16862BF | Recombinant Full Length Bovine Enteropeptidase(Tmprss15) Protein, His-Tagged | +Inquiry |
TMPRSS15-02H | Recombinant Bovine TMPRSS15 Protein, His-tagged | +Inquiry |
Tmprss15-2135R | Recombinant Rat Tmprss15 Protein, His-tagged | +Inquiry |
TMPRSS15-17119M | Recombinant Mouse TMPRSS15 Protein, His-tagged | +Inquiry |
TMPRSS15-0030B | Recombinant Bovine TMPRSS15 Protein (Lys800-His1035), C-His-tagged | +Inquiry |
◆ Native Proteins | ||
TMPRSS15-001H | Recombinant Human TMPRSS15 Protein, His-tagged | +Inquiry |
◆ Cell & Tissue Lysates | ||
TMPRSS15-2800HCL | Recombinant Human PRSS7 293 Cell Lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews (0)
- Q&As (0)
Ask a Question for All TMPRSS15 Products
Required fields are marked with *
My Review for All TMPRSS15 Products
Required fields are marked with *