Recombinant Full Length Pig Microsomal Glutathione S-Transferase 1(Mgst1) Protein, His-Tagged
| Cat.No. : | RFL1101SF |
| Product Overview : | Recombinant Full Length Pig Microsomal glutathione S-transferase 1(MGST1) Protein (P79382) (2-155aa), fused to N-terminal His tag, was expressed in E. coli. |
- Specification
- Gene Information
- Related Products
- Download
| Species : | Sus scrofa (Pig) |
| Source : | E.coli |
| Tag : | His |
| Protein Length : | Full Length of Mature Protein (2-155) |
| Form : | Lyophilized powder |
| AA Sequence : | ADLTELMKNEVFMAFASYATIVLSKMMFMSTATAFYRLTRKVFANPEDCSSFGKGENAKK YLRTDERVERVRRAHLNDLENIVPFLGIGLLYSLSGPDLSTAILHFRLFVGARIYHTIAY LTPLPQPNRGLAFFLGYGVTLSMAYRLLKSRLYL |
| Purity : | Greater than 90% as determined by SDS-PAGE. |
| Applications : | SDS-PAGE |
| Notes : | Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week. |
| Storage : | Store at -20°C/-80°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. |
| Storage Buffer : | Tris/PBS-based buffer, 6% Trehalose, pH 8.0 |
| Reconstitution : | We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20℃/-80℃. Our default final concentration of glycerol is 50%. Customers could use it as reference. |
| Gene Name | MGST1 |
| Synonyms | MGST1; GST12; Microsomal glutathione S-transferase 1; Microsomal GST-1; Microsomal GST-I |
| UniProt ID | P79382 |
| ◆ Recombinant Proteins | ||
| MGST1-305HF | Recombinant Full Length Human MGST1 Protein | +Inquiry |
| MGST1-3473H | Recombinant Human MGST1 Protein, His (Fc)-Avi-tagged | +Inquiry |
| Mgst1-2653M | Recombinant Mouse Mgst1 protein, His & GST-tagged | +Inquiry |
| MGST1-30203TH | Recombinant Human MGST1 | +Inquiry |
| RFL7688BF | Recombinant Full Length Bovine Microsomal Glutathione S-Transferase 1(Mgst1) Protein, His-Tagged | +Inquiry |
| ◆ Cell & Tissue Lysates | ||
| MGST1-1110HCL | Recombinant Human MGST1 cell lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews (0)
- Q&As (0)
Ask a Question for All MGST1 Products
Required fields are marked with *
My Review for All MGST1 Products
Required fields are marked with *



