Recombinant Full Length Pig Parathyroid Hormone/Parathyroid Hormone-Related Peptide Receptor(Pth1R) Protein, His-Tagged
Cat.No. : | RFL7353SF |
Product Overview : | Recombinant Full Length Pig Parathyroid hormone/parathyroid hormone-related peptide receptor(PTH1R) Protein (P50133) (27-585aa), fused to N-terminal His tag, was expressed in E. coli. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Sus scrofa (Pig) |
Source : | E.coli |
Tag : | His |
Protein Length : | Full Length of Mature Protein (27-585) |
Form : | Lyophilized powder |
AA Sequence : | DADDVMTKEEQIFLLHRAQAQCEKRLKEVLQRPADIMESDKGWASAPTSGKPRKEKASGK LYPESGEDTGSRHQGRPCLPEWDHILCWPLGAPGEVVAMPCPDYIYDFNHKGHAYRRCDR NGSWELVPGHNRTWANYSECVKFLTNETREREVFDRLGMIYTVGYSVSLASLTVAVLILA YFRRLHCTRNYIHMHLFLSFMLRAVSIFVKDAVLYSGATLDEAERLTEEELRAIAQAPLP PVAATSYVGCRVAVTFFLYFLATNYYWILVEGLYLHSLIFMAFFSEKKYLWGFTVFGWGL PAIFVAVWVSVRATLANTGCWDLSSGNKKWIIQVPILASIVLNFILFINIVRVLATKLRE TNAGRCDTRQQYRKLLKSTLVLMPLFGVHYIVFMATPYTEVSGTLWQVQMHYEMLFNSFQ GFFVAIIYCFCNGEVQAEIKKSWSRWTLALDFKRKARSGSSSYSYGPMVSHTSVTNVGPR TGLGLPLSPRLLPAATTNGHPQLPCHTKPETPALQTTPPVVAAPKDDGFLNGSCSGLDEE ASAPERPSVLLQEEWETVM |
Purity : | Greater than 90% as determined by SDS-PAGE. |
Applications : | SDS-PAGE |
Notes : | Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week. |
Storage : | Store at -20°C/-80°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. |
Storage Buffer : | Tris/PBS-based buffer, 6% Trehalose, pH 8.0 |
Reconstitution : | We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20℃/-80℃. Our default final concentration of glycerol is 50%. Customers could use it as reference. |
Gene Name | PTH1R |
Synonyms | PTH1R; PTHR; PTHR1; Parathyroid hormone/parathyroid hormone-related peptide receptor; PTH/PTHrP type I receptor; PTH/PTHr receptor; Parathyroid hormone 1 receptor; PTH1 receptor |
UniProt ID | P50133 |
◆ Recombinant Proteins | ||
PTH1R-6077H | Recombinant Human PTH1R Protein (Ala28-Gly188), His tagged | +Inquiry |
PTH1R-4087C | Recombinant Chicken PTH1R | +Inquiry |
PTH1R-4819R | Recombinant Rat PTH1R Protein, His-tagged | +Inquiry |
PTH1R-1051HFL | Recombinant Full Length Human PTH1R protein, His&Flag-tagged | +Inquiry |
RFL4064RF | Recombinant Full Length Rat Parathyroid Hormone/Parathyroid Hormone-Related Peptide Receptor(Pth1R) Protein, His-Tagged | +Inquiry |
◆ Cell & Tissue Lysates | ||
PTH1R-1841HCL | Recombinant Human PTH1R cell lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews (0)
- Q&As (0)
Ask a Question for All PTH1R Products
Required fields are marked with *
My Review for All PTH1R Products
Required fields are marked with *
0
Inquiry Basket