Recombinant Full Length Pig Prostaglandin E2 Receptor Ep3 Subtype(Ptger3) Protein, His-Tagged
Cat.No. : | RFL13520SF |
Product Overview : | Recombinant Full Length Pig Prostaglandin E2 receptor EP3 subtype(PTGER3) Protein (P50131) (1-373aa), fused to N-terminal His tag, was expressed in E. coli. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Sus scrofa (Pig) |
Source : | E.coli |
Tag : | His |
Protein Length : | Full Length (1-373) |
Form : | Lyophilized powder |
AA Sequence : | MWAPERSAEEQGNLTRSLGSSEDCGSVSVVFPMTMLITGFVGNALAMLLVSQSYRRRESK RKKSFLLCIGWLALTDMVGQLLTSPVVIVLYLSHQRWEQLDPSGRLCTFFGLTMTAFGLS SLFIASAMAVERALAIRAPHWYSSHMKTSATRAVLLGVWLAVLAFALLPVLGVGQYTIQW PGTWCFISTRTGGNETSSENNWGNIFFASAFSFLGLSALVVTFACNLATIKALVSRCRAK ATASQSSAQWGRITTETAIQLMGIMCVLSVCWSPLLIMMLKTIFNQTSVEYCKVYTEKQN ECNFFLIAVRLASLNQILDPWVYLLLRKILLQKFCQAVSQKQREEAATLIFTHLSISRTE PGEARVLFSKSKC |
Purity : | Greater than 90% as determined by SDS-PAGE. |
Applications : | SDS-PAGE |
Notes : | Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week. |
Storage : | Store at -20°C/-80°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. |
Storage Buffer : | Tris/PBS-based buffer, 6% Trehalose, pH 8.0 |
Reconstitution : | We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20℃/-80℃. Our default final concentration of glycerol is 50%. Customers could use it as reference. |
Gene Name | PTGER3 |
Synonyms | PTGER3; Prostaglandin E2 receptor EP3 subtype; PGE receptor EP3 subtype; PGE2 receptor EP3 subtype; Prostanoid EP3 receptor |
UniProt ID | P50131 |
◆ Recombinant Proteins | ||
PTGER3-371H | Recombinant Human PTGER3 Protein, His/GST-tagged | +Inquiry |
RFL21274RF | Recombinant Full Length Rat Prostaglandin E2 Receptor Ep3 Subtype(Ptger3) Protein, His-Tagged | +Inquiry |
RFL13520SF | Recombinant Full Length Pig Prostaglandin E2 Receptor Ep3 Subtype(Ptger3) Protein, His-Tagged | +Inquiry |
PTGER3-3417C | Recombinant Chicken PTGER3 | +Inquiry |
PTGER3-4808R | Recombinant Rat PTGER3 Protein | +Inquiry |
◆ Cell & Tissue Lysates | ||
PTGER3-2717HCL | Recombinant Human PTGER3 293 Cell Lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews
- Q&As
Ask a Question for All PTGER3 Products
Required fields are marked with *
My Review for All PTGER3 Products
Required fields are marked with *
0
Inquiry Basket