Recombinant Full Length Pig Protein Delta Homolog 2(Dlk2) Protein, His-Tagged
Cat.No. : | RFL627SF |
Product Overview : | Recombinant Full Length Pig Protein delta homolog 2(DLK2) Protein (B2LW77) (27-383aa), fused to N-terminal His tag, was expressed in E. coli. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Sus scrofa (Pig) |
Source : | E.coli |
Tag : | His |
Protein Length : | Full Length of Mature Protein (27-383) |
Form : | Lyophilized powder |
AA Sequence : | DDCSSHCDLAHGCCAPDGSCRCDPGWEGLHCERCVRMPGCQHGTCHQPWQCICHSGWAGKFCDKDEHVCTTQSPCRNGGQCIYDGGGEYHCVCPPGFHGRDCERKEGPCEQAGSPCRNGGQCQDDQGFALNYTCRCLAGFVGAHCEVNVDDCLMRPCANGATCLDGINRFSCLCPEGFAGRFCTINLDDCASRPCQRGARCRDRVHDFDCLCPSGYGGKTCELVLPVPDPATTADIPPGPTLAVVVPATGPIPHSAGAGLLRISVKEVVRRQEAGLGKSSLVAVVVFGAVTATLVLSTVLLTLRAWRRGVCPPGPCCYPAPHYAPARQDQECQVSMLPAGLPLPPDLPPEPGKTTAL |
Purity : | Greater than 90% as determined by SDS-PAGE. |
Applications : | SDS-PAGE |
Notes : | Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week. |
Storage : | Store at -20°C/-80°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. |
Storage Buffer : | Tris/PBS-based buffer, 6% Trehalose, pH 8.0 |
Reconstitution : | We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20℃/-80℃. Our default final concentration of glycerol is 50%. Customers could use it as reference. |
Gene Name | DLK2 |
Synonyms | DLK2; EGFL9; Protein delta homolog 2; DLK-2; Epidermal growth factor-like protein 9; EGF-like protein 9 |
UniProt ID | B2LW77 |
◆ Recombinant Proteins | ||
RFL11073RF | Recombinant Full Length Rat Protein Delta Homolog 2(Dlk2) Protein, His-Tagged | +Inquiry |
DLK2-1886R | Recombinant Rat DLK2 Protein | +Inquiry |
DLK2-1279R | Recombinant Rhesus monkey DLK2 Protein, His-tagged | +Inquiry |
DLK2-1044H | Recombinant Human DLK2 Protein (27-306 aa), GST-tagged | +Inquiry |
DLK2-2334M | Recombinant Mouse DLK2 Protein (27-305 aa), His-tagged | +Inquiry |
◆ Cell & Tissue Lysates | ||
DLK2-536HCL | Recombinant Human DLK2 cell lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews (0)
- Q&As (0)
Ask a Question for All DLK2 Products
Required fields are marked with *
My Review for All DLK2 Products
Required fields are marked with *
0
Inquiry Basket