Recombinant Human DLK2 Protein (27-306 aa), His-tagged

• Cat.No.: DLK2-1676H
• Product Overview: Recombinant Human DLK2 Protein (27-306 aa) is produced by Yeast expression system. This protein is fused with a 6xHis tag at the N-terminal. Research Area: Signal Transduction. Protein Description: Partial.

Specification

• Species: Human
• Source: Yeast
• Tag: His
• Protein Length: 27-306 aa
• Description: Regulates adipogenesis.
• Form: Tris-based buffer,50% glycerol
• Molecular Mass: 31.8 kDa
• AA Sequence: DDCSSHCDLAHGCCAPDGSCRCDPGWEGLHCERCVRMPGCQHGTCHQPWQCICHSGWAGKFCDKDEHICTTQSPCQNGGQCMYDGGGEYHCVCLPGFHGRDCERKAGPCEQAGSPCRNGGQCQDDQGFALNFTCRCLVGFVGARCEVNVDDCLMRPCANGATCLDGINRFSCLCPEGFAGRFCTINLDDCASRPCQRGARCRDRVHDFDCLCPSGYGGKTCELVLPVPDPPTTVDTPLGPTSAVVVPATGPAPHSAGAGLLRISVKEVVRRQEAGLGEPS
• Purity: > 90% as determined by SDS-PAGE.
• Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4 centigrade for up to one week.
• Storage: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20 centigrade/-80 centigrade. The shelf life of lyophilized form is 12 months at -20 centigrade/-80 centigrade.
• Concentration: A hardcopy of COA with reconstitution instruction is sent along with the products.

Gene Information

• Gene Name: DLK2 delta-like 2 homolog (Drosophila) [ Homo sapiens ]
• Official Symbol: DLK2
• Synonyms: DLK2; MGC2487; DLK-2; EGF-like protein 9; EGFL9; MGC111055
• Gene ID: 65989
• mRNA Refseq: NM_023932
• Protein Refseq: NP_076421
• UniProt ID: Q6UY11