Recombinant Full Length Pongo Abelii Adp/Atp Translocase 2(Slc25A5) Protein, His-Tagged
Cat.No. : | RFL31409PF |
Product Overview : | Recombinant Full Length Pongo abelii ADP/ATP translocase 2(SLC25A5) Protein (Q5R5A1) (2-298aa), fused to N-terminal His tag, was expressed in E. coli. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Pongo Abelii |
Source : | E.coli |
Tag : | His |
Protein Length : | Full Length of Mature Protein (2-298) |
Form : | Lyophilized powder |
AA Sequence : | TDAAVSFAKDFLAGGVAAAISKTAVAPIERVKLLLQVQHASKQITADKQYKGIIDCVVRI PKEQGVLSFWRGNLANVIRHFPTQALNFAFKDKYKQIFLGGVDKRTQFWRYFAGNLASGG AAGATSLCFVYPLDFARTRLAADVGKAGAEREFRGLGDCLVKIYKSDGIKGLYQGFNVSV QGIIIYRAAYFGIYDTAKGMLPDPKNTHIVISWMIAQTVTAVAGLTSYPFDTVRRRMMMQ SGRKGTDIMYTGTLDCWRKIARDEGGKAFFKGAWSNVLRGMGGAFALVLYDEIKKYT |
Purity : | Greater than 90% as determined by SDS-PAGE. |
Notes : | Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week. |
Storage : | Store at -20°C/-80°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. |
Storage Buffer : | Tris/PBS-based buffer, 6% Trehalose, pH 8.0 |
Reconstitution : | We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20℃/-80℃. Our default final concentration of glycerol is 50%. Customers could use it as reference. |
Gene Name | SLC25A5 |
Synonyms | SLC25A5; ADP/ATP translocase 2; ADP,ATP carrier protein 2; Adenine nucleotide translocator 2; ANT 2; Solute carrier family 25 member 5 |
UniProt ID | Q5R5A1 |
◆ Recombinant Proteins | ||
SLC25A5-15336M | Recombinant Mouse SLC25A5 Protein | +Inquiry |
RFL29648MF | Recombinant Full Length Mouse Adp/Atp Translocase 2(Slc25A5) Protein, His-Tagged | +Inquiry |
SLC25A5-1550H | Recombinant Human SLC25A5 Protein, Myc/DDK-tagged, C13 and N15-labeled | +Inquiry |
SLC25A5-8297M | Recombinant Mouse SLC25A5 Protein, His (Fc)-Avi-tagged | +Inquiry |
SLC25A5-0075H | Recombinant Human SLC25A5 Protein (T2-T298), 8×His-MBP, Flag tagged | +Inquiry |
◆ Cell & Tissue Lysates | ||
SLC25A5-1757HCL | Recombinant Human SLC25A5 293 Cell Lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews (0)
- Q&As (0)
Ask a Question for All SLC25A5 Products
Required fields are marked with *
My Review for All SLC25A5 Products
Required fields are marked with *