Recombinant Full Length Pongo Abelii B-Cell Receptor-Associated Protein 29(Bcap29) Protein, His-Tagged
Cat.No. : | RFL26421PF |
Product Overview : | Recombinant Full Length Pongo abelii B-cell receptor-associated protein 29(BCAP29) Protein (Q5R9U7) (1-241aa), fused to N-terminal His tag, was expressed in E. coli. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Pongo Abelii |
Source : | E.coli |
Tag : | His |
Protein Length : | Full Length (1-241) |
Form : | Lyophilized powder |
AA Sequence : | MTLQWAAVATFLYAEIGLILIFCLPFIPPQRWQKIFSFNVWGKIATFWNKAFLTIIILLI VLFLDAVREVRKYSSVHTIEKSSTSRPDAYEHTQMKLFRSQRNLYISGFSLFFWLVLRRL VTLITQLAKELSNKGVLKTQAENTNKAAKKFMEENEKLKRILKSHGKDEECVLEAENKKL VEDQQKLKTELRKTSDALSKAQNDVMEMKMQSERLSKEYDQLLKEHSELQDRLERGNKKR L |
Purity : | Greater than 90% as determined by SDS-PAGE. |
Applications : | SDS-PAGE |
Notes : | Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week. |
Storage : | Store at -20°C/-80°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. |
Storage Buffer : | Tris/PBS-based buffer, 6% Trehalose, pH 8.0 |
Reconstitution : | We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20℃/-80℃. Our default final concentration of glycerol is 50%. Customers could use it as reference. |
Gene Name | BCAP29 |
Synonyms | BCAP29; B-cell receptor-associated protein 29; BCR-associated protein 29; Bap29 |
UniProt ID | Q5R9U7 |
◆ Recombinant Proteins | ||
BCAP29-6256H | Recombinant Human BCAP29 Protein, Myc/DDK-tagged, C13 and N15-labeled | +Inquiry |
BCAP29-3704C | Recombinant Chicken BCAP29 | +Inquiry |
RFL2890HF | Recombinant Full Length Human B-Cell Receptor-Associated Protein 29(Bcap29) Protein, His-Tagged | +Inquiry |
Bcap29-692M | Recombinant Mouse Bcap29 Protein, MYC/DDK-tagged | +Inquiry |
BCAP29-517R | Recombinant Rhesus monkey BCAP29 Protein, His-tagged | +Inquiry |
◆ Cell & Tissue Lysates | ||
BCAP29-161HCL | Recombinant Human BCAP29 cell lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews (0)
- Q&As (0)
Ask a Question for All BCAP29 Products
Required fields are marked with *
My Review for All BCAP29 Products
Required fields are marked with *