Recombinant Human BCAP29 Protein, GST-tagged
| Cat.No. : | BCAP29-116H |
| Product Overview : | Human BCAP29 full-length ORF ( NP_061332.2, 1 a.a. - 241 a.a.) recombinant protein with GST-tag at N-terminal. |
- Specification
- Gene Information
- Related Products
- Download
| Species : | Human |
| Source : | Wheat Germ |
| Tag : | GST |
| Form : | 50 mM Tris-HCI, 10 mM reduced Glutathione, pH=8.0 in the elution buffer. |
| Molecular Mass : | 54.7 kDa |
| AA Sequence : | MTLQWAAVATFLYAEIGLILIFCLPFIPPQRWQKIFSFNVWGKIATFWNKAFLTIIILLIVLFLDAVREVRKYSSVHTIEKSSTSRPDAYEHTQMKLFRSQRNLYISGFSLFFWLVLRRLVTLITQLAKELSNKGVLKTQAENTNKAAKKFMEENEKLKRILKSHGKDEECVLEAENKKLVEDQEKLKTELRKTSDALSKAQNDVMEMKMQSERLSKEYDQLLKEHSELQDRLERGNKKRL |
| Notes : | Best use within three months from the date of receipt of this protein. |
| Storage : | Store at -80 centigrade. Aliquot to avoid repeated freezing and thawing. |
| Storage Buffer : | 50 mM Tris-HCI, 10 mM reduced Glutathione, pH=8.0 in the elution buffer. |
| Gene Name | BCAP29 B-cell receptor-associated protein 29 [ Homo sapiens ] |
| Official Symbol | BCAP29 |
| Synonyms | BCAP29; B-cell receptor-associated protein 29; BAP29; DKFZp686M2086; BCR-associated protein 29; FLJ53907; |
| Gene ID | 55973 |
| mRNA Refseq | NM_001008405 |
| Protein Refseq | NP_001008405 |
| UniProt ID | Q9UHQ4 |
| ◆ Cell & Tissue Lysates | ||
| BCAP29-161HCL | Recombinant Human BCAP29 cell lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews (0)
- Q&As (0)
Ask a Question for All BCAP29 Products
Required fields are marked with *
My Review for All BCAP29 Products
Required fields are marked with *
