Recombinant Human BCAP29 Protein, GST-tagged

Cat.No. : BCAP29-116H
Product Overview : Human BCAP29 full-length ORF ( NP_061332.2, 1 a.a. - 241 a.a.) recombinant protein with GST-tag at N-terminal.
  • Specification
  • Gene Information
  • Related Products
  • Download
Species : Human
Source : Wheat Germ
Tag : GST
Form : 50 mM Tris-HCI, 10 mM reduced Glutathione, pH=8.0 in the elution buffer.
Molecular Mass : 54.7 kDa
AA Sequence : MTLQWAAVATFLYAEIGLILIFCLPFIPPQRWQKIFSFNVWGKIATFWNKAFLTIIILLIVLFLDAVREVRKYSSVHTIEKSSTSRPDAYEHTQMKLFRSQRNLYISGFSLFFWLVLRRLVTLITQLAKELSNKGVLKTQAENTNKAAKKFMEENEKLKRILKSHGKDEECVLEAENKKLVEDQEKLKTELRKTSDALSKAQNDVMEMKMQSERLSKEYDQLLKEHSELQDRLERGNKKRL
Notes : Best use within three months from the date of receipt of this protein.
Storage : Store at -80 centigrade. Aliquot to avoid repeated freezing and thawing.
Storage Buffer : 50 mM Tris-HCI, 10 mM reduced Glutathione, pH=8.0 in the elution buffer.
Gene Name BCAP29 B-cell receptor-associated protein 29 [ Homo sapiens ]
Official Symbol BCAP29
Synonyms BCAP29; B-cell receptor-associated protein 29; BAP29; DKFZp686M2086; BCR-associated protein 29; FLJ53907;
Gene ID 55973
mRNA Refseq NM_001008405
Protein Refseq NP_001008405
UniProt ID Q9UHQ4

Not For Human Consumption!

Inquiry

  • Reviews (0)
  • Q&As (0)

Customer Reviews

Write a review

Ask a Question for All BCAP29 Products

Required fields are marked with *

My Review for All BCAP29 Products

Required fields are marked with *

0
cart-icon