Recombinant Full Length Pongo Abelii C3A Anaphylatoxin Chemotactic Receptor(C3Ar1) Protein, His-Tagged
Cat.No. : | RFL30741PF |
Product Overview : | Recombinant Full Length Pongo abelii C3a anaphylatoxin chemotactic receptor(C3AR1) Protein (Q5REI5) (1-482aa), fused to N-terminal His tag, was expressed in E. coli. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Pongo Abelii |
Source : | E.coli |
Tag : | His |
Protein Length : | Full Length (1-482) |
Form : | Lyophilized powder |
AA Sequence : | MASFSAETNSTDLLSQPWNEPPVILSMVILSLTFLLGLPGNGLVLWVAGLKMQRTVNTVW FLHLTLADLLCCLSLPFSLAHLALQGQWPYGRFLCELIPSIIVLNMFASVFLLTAISLDR CLVVFKPIWCQNHRNVGTACSICGCIWVVAFVMCIPVFVYREIFTADNHNRCGYKFGLSS SLDYPDFYGDPLENRSLENIVQLPGEMNDRLDPSSFQTNDHPWTVPTVFQPQTFQRPSAD SLHRDSARLTSQNLYSNVFKPADVVSPKIPSGFPIKDQETSPLDNSDAFLSTHLKLFPSA SSNSFYESELPQDFQDYYNLGQFEDDNQVPTPLVAITITRLVVGFLLPSVIMIACYSFIV FRMQRGRFAKSQSKTFRVAVVVVAVFLVCWTPYHIFGVLSLLIDPESPLGKTLMSWDHVS IALASANSCFNPFLYALLGKDFRKKARQSIQGILEAAFSEELTRSTHCNSNNVFSERNST TV |
Purity : | Greater than 90% as determined by SDS-PAGE. |
Notes : | Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week. |
Storage : | Store at -20°C/-80°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. |
Storage Buffer : | Tris/PBS-based buffer, 6% Trehalose, pH 8.0 |
Reconstitution : | We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20℃/-80℃. Our default final concentration of glycerol is 50%. Customers could use it as reference. |
Gene Name | C3AR1 |
Synonyms | C3AR1; C3a anaphylatoxin chemotactic receptor; C3AR; C3a-R |
UniProt ID | Q5REI5 |
◆ Recombinant Proteins | ||
C3AR1-694HFL | Recombinant Full Length Human C3AR1 Protein, C-Flag-tagged | +Inquiry |
C3AR1-1837H | Recombinant Human C3AR1 Protein, MYC/DDK-tagged | +Inquiry |
RFL16903HF | Recombinant Full Length Human C3A Anaphylatoxin Chemotactic Receptor(C3Ar1) Protein, His-Tagged | +Inquiry |
C3aR1-1151HFL | Recombinant Human C3aR1 protein, His&Flag-tagged | +Inquiry |
C3AR1-1146M | Recombinant Mouse C3AR1 Protein, His (Fc)-Avi-tagged | +Inquiry |
◆ Cell & Tissue Lysates | ||
C3AR1-243HCL | Recombinant Human C3AR1 cell lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews (0)
- Q&As (0)
Ask a Question for All C3AR1 Products
Required fields are marked with *
My Review for All C3AR1 Products
Required fields are marked with *
0
Inquiry Basket