Recombinant Full Length Pongo Abelii Epithelial Membrane Protein 1(Emp1) Protein, His-Tagged
| Cat.No. : | RFL6075PF |
| Product Overview : | Recombinant Full Length Pongo abelii Epithelial membrane protein 1(EMP1) Protein (Q5RCY3) (1-157aa), fused to N-terminal His tag, was expressed in E. coli. |
- Specification
- Gene Information
- Related Products
- Download
| Species : | Pongo Abelii |
| Source : | E.coli |
| Tag : | His |
| Protein Length : | Full Length (1-157) |
| Form : | Lyophilized powder |
| AA Sequence : | MLVLLAGIFVVHIATVIMLFVSTIANVWLVSNTVDASVGLWKNCTNISCSDSLSYASEDA LKTVQAFMILSIIFCVIALLVFVFQLFTMEKGNRFFLSGATTLVCWLCILVGVSIYTSHY ANRDGTQYHHGYSYILGWICFCFSFIIGVLYLVLRKK |
| Purity : | Greater than 90% as determined by SDS-PAGE. |
| Applications : | SDS-PAGE |
| Notes : | Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week. |
| Storage : | Store at -20°C/-80°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. |
| Storage Buffer : | Tris/PBS-based buffer, 6% Trehalose, pH 8.0 |
| Reconstitution : | We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20℃/-80℃. Our default final concentration of glycerol is 50%. Customers could use it as reference. |
| Gene Name | EMP1 |
| Synonyms | EMP1; Epithelial membrane protein 1; EMP-1 |
| UniProt ID | Q5RCY3 |
| ◆ Recombinant Proteins | ||
| EMP1-2778M | Recombinant Mouse EMP1 Protein, His (Fc)-Avi-tagged | +Inquiry |
| RFL6075PF | Recombinant Full Length Pongo Abelii Epithelial Membrane Protein 1(Emp1) Protein, His-Tagged | +Inquiry |
| EMP1-4785C | Recombinant Chicken EMP1 | +Inquiry |
| EMP1-4249HF | Recombinant Full Length Human EMP1 Protein, GST-tagged | +Inquiry |
| Emp1-2815M | Recombinant Mouse Emp1 Protein, Myc/DDK-tagged | +Inquiry |
| ◆ Cell & Tissue Lysates | ||
| EMP1-6607HCL | Recombinant Human EMP1 293 Cell Lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews (0)
- Q&As (0)
Ask a Question for All EMP1 Products
Required fields are marked with *
My Review for All EMP1 Products
Required fields are marked with *
