Recombinant Full Length Pongo Abelii Lysosomal-Associated Transmembrane Protein 4A(Laptm4A) Protein, His-Tagged
Cat.No. : | RFL6070PF |
Product Overview : | Recombinant Full Length Pongo abelii Lysosomal-associated transmembrane protein 4A(LAPTM4A) Protein (Q5RAH0) (1-233aa), fused to N-terminal His tag, was expressed in E. coli. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Pongo Abelii |
Source : | E.coli |
Tag : | His |
Protein Length : | Full Length (1-233) |
Form : | Lyophilized powder |
AA Sequence : | MVSMSFKRNRSDRFYSTRCCGCCHVRTGTIILGTWYMVVNLLMAILLTVEVTHPNSMPAV NIQYEVIGNYYSSERMADNACVLFAVSVLMFIISSMLVYGAISYQVGWLIPFFCYRLFDF VLSCLVAISSLTYLPRIKEYLDQLPDFPYKDDLLALDSSCLLFIVLVFFALFIIFKAYLI NCVWNCYKYINNRNVPEIAVYPAFEAPPQYVLPTYEMAVKMPEKEPPPPYLPA |
Purity : | Greater than 90% as determined by SDS-PAGE. |
Notes : | Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week. |
Storage : | Store at -20°C/-80°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. |
Storage Buffer : | Tris/PBS-based buffer, 6% Trehalose, pH 8.0 |
Reconstitution : | We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20℃/-80℃. Our default final concentration of glycerol is 50%. Customers could use it as reference. |
Gene Name | LAPTM4A |
Synonyms | LAPTM4A; Lysosomal-associated transmembrane protein 4A |
UniProt ID | Q5RAH0 |
◆ Recombinant Proteins | ||
LAPTM4A-2767C | Recombinant Chicken LAPTM4A | +Inquiry |
LAPTM4A-2463R | Recombinant Rhesus monkey LAPTM4A Protein, His-tagged | +Inquiry |
Laptm4a-3754M | Recombinant Mouse Laptm4a Protein, Myc/DDK-tagged | +Inquiry |
RFL15996RF | Recombinant Full Length Rat Lysosomal-Associated Transmembrane Protein 4A(Laptm4A) Protein, His-Tagged | +Inquiry |
RFL20064HF | Recombinant Full Length Human Lysosomal-Associated Transmembrane Protein 4A(Laptm4A) Protein, His-Tagged | +Inquiry |
◆ Cell & Tissue Lysates | ||
LAPTM4A-4823HCL | Recombinant Human LAPTM4A 293 Cell Lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews (0)
- Q&As (0)
Ask a Question for All LAPTM4A Products
Required fields are marked with *
My Review for All LAPTM4A Products
Required fields are marked with *