Recombinant Full Length Pyrobaculum Arsenaticum Upf0290 Protein Pars_2316 (Pars_2316) Protein, His-Tagged
| Cat.No. : | RFL11724PF |
| Product Overview : | Recombinant Full Length Pyrobaculum arsenaticum UPF0290 protein Pars_2316 (Pars_2316) Protein (A4WN93) (1-164aa), fused to N-terminal His tag, was expressed in E. coli. |
- Specification
- Gene Information
- Related Products
- Download
| Species : | Pyrobaculum arsenaticum |
| Source : | E.coli |
| Tag : | His |
| Protein Length : | Full Length (1-164) |
| Form : | Lyophilized powder |
| AA Sequence : | MDLFVFFALIWPPYVANGSAVLASRLKWRHPVDFGHNFVDGRRLFGDGKTYEGLAIGVVL GTVVGYLPNLLHPTLTLLDALILSVAALLGDLLGAFIKRRLCMPRGHPAFPLDQLDFILM AMLVRSLYADVPVEYIIAASVVTPIIHRATNIAAYILRLKKEPW |
| Purity : | Greater than 90% as determined by SDS-PAGE. |
| Notes : | Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week. |
| Storage : | Store at -20°C/-80°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. |
| Storage Buffer : | Tris/PBS-based buffer, 6% Trehalose, pH 8.0 |
| Reconstitution : | We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20℃/-80℃. Our default final concentration of glycerol is 50%. Customers could use it as reference. |
| Gene Name | carS |
| Synonyms | carS; Pars_2316; CDP-archaeol synthase; CDP-2,3-bis-(O-geranylgeranyl-sn-glycerol synthase |
| UniProt ID | A4WN93 |
| ◆ Recombinant Proteins | ||
| CARS-0403H | Recombinant Human CARS Protein, GST-Tagged | +Inquiry |
| RFL3948AF | Recombinant Full Length Aeropyrum Pernix Upf0290 Protein Ape_0433(Ape_0433) Protein, His-Tagged | +Inquiry |
| CARS-1955C | Recombinant Chicken CARS | +Inquiry |
| CARS-6566Z | Recombinant Zebrafish CARS | +Inquiry |
| RFL7060HF | Recombinant Full Length Hyperthermus Butylicus Upf0290 Protein Hbut_1639 (Hbut_1639) Protein, His-Tagged | +Inquiry |
| ◆ Cell & Tissue Lysates | ||
| CARS-7845HCL | Recombinant Human CARS 293 Cell Lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews (0)
- Q&As (0)
Ask a Question for All carS Products
Required fields are marked with *
My Review for All carS Products
Required fields are marked with *



