Recombinant Full Length Rabbit Anion Exchange Transporter(Slc26A7) Protein, His-Tagged
Cat.No. : | RFL25096OF |
Product Overview : | Recombinant Full Length Rabbit Anion exchange transporter(SLC26A7) Protein (Q8HY59) (1-128aa), fused to N-terminal His tag, was expressed in E. coli. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Oryctolagus cuniculus |
Source : | E.coli |
Tag : | His |
Protein Length : | Full Length (1-128) |
Form : | Lyophilized powder |
AA Sequence : | LFSFKELNEQFKRKIKVVLPVDLVLIIAASFACYCTNMENTYGLEVVGHIPRGIPPPRAP PMNILSAVITEAFGVALVGYAASLALAQGSAKKFKYSVDDNQEFLAHGLSNVISSFLFCI PSAAAMGR |
Purity : | Greater than 90% as determined by SDS-PAGE. |
Notes : | Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week. |
Storage : | Store at -20°C/-80°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. |
Storage Buffer : | Tris/PBS-based buffer, 6% Trehalose, pH 8.0 |
Reconstitution : | We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20℃/-80℃. Our default final concentration of glycerol is 50%. Customers could use it as reference. |
Gene Name | SLC26A7 |
Synonyms | SLC26A7; Anion exchange transporter; Solute carrier family 26 member 7; Fragment |
UniProt ID | Q8HY59 |
◆ Recombinant Proteins | ||
SLC26A7-2071H | Recombinant Human SLC26A7 Protein, His&GST-tagged | +Inquiry |
SLC26A7-2735H | Recombinant Human SLC26A7, GST-tagged | +Inquiry |
SLC26A7-8303M | Recombinant Mouse SLC26A7 Protein, His (Fc)-Avi-tagged | +Inquiry |
SLC26A7-15345M | Recombinant Mouse SLC26A7 Protein | +Inquiry |
RFL25096OF | Recombinant Full Length Rabbit Anion Exchange Transporter(Slc26A7) Protein, His-Tagged | +Inquiry |
◆ Cell & Tissue Lysates | ||
SLC26A7-1751HCL | Recombinant Human SLC26A7 293 Cell Lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews (0)
- Q&As (0)
Ask a Question for All SLC26A7 Products
Required fields are marked with *
My Review for All SLC26A7 Products
Required fields are marked with *