Recombinant Full Length Rabbit B2 Bradykinin Receptor(Bdkrb2) Protein, His-Tagged
Cat.No. : | RFL8845OF |
Product Overview : | Recombinant Full Length Rabbit B2 bradykinin receptor(BDKRB2) Protein (Q28642) (1-367aa), fused to N-terminal His tag, was expressed in E. coli. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Oryctolagus cuniculus |
Source : | E.coli |
Tag : | His |
Protein Length : | Full Length (1-367) |
Form : | Lyophilized powder |
AA Sequence : | MLNITSQVLAPALNGSVSQSSGCPNTEWSGWLNVIQAPFLWVLFVLATLENLFVLSVFCL HKSSCTVAEVYLGNLAAADLILACGLPFWAVTIANHFDWLFGEALCRVVNTMIYMNLYSS ICFLMLVSIDRYLALVKTMSIGRMRRVRWAKLYSLVIWGCTLLLSSPMLVFRTMKDYRDE GYNVTACIIDYPSRSWEVFTNVLLNLVGFLLPLSVITFCTVQILQVLRNNEMQKFKEIQT ERRATVLVLAVLLLFVVCWLPFQVSTFLDTLLKLGVLSSCWDEHVIDVITQVGSFMGYSN SCLNPLVYVIVGKRFRKKSREVYRAACPKAGCVLEPVQAESSMGTLRTSISVERQIHKLP EWTRSSQ |
Purity : | Greater than 90% as determined by SDS-PAGE. |
Notes : | Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week. |
Storage : | Store at -20°C/-80°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. |
Storage Buffer : | Tris/PBS-based buffer, 6% Trehalose, pH 8.0 |
Reconstitution : | We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20℃/-80℃. Our default final concentration of glycerol is 50%. Customers could use it as reference. |
Gene Name | BDKRB2 |
Synonyms | BDKRB2; B2 bradykinin receptor; B2R; BK-2 receptor |
UniProt ID | Q28642 |
◆ Recombinant Proteins | ||
BDKRB2-1565HF | Recombinant Full Length Human BDKRB2 Protein, GST-tagged | +Inquiry |
RFL8845OF | Recombinant Full Length Rabbit B2 Bradykinin Receptor(Bdkrb2) Protein, His-Tagged | +Inquiry |
BDKRB2-185H | Recombinant Human BDKRB2 Protein, GST-tagged | +Inquiry |
BDKRB2-341C | Recombinant Cynomolgus BDKRB2 Protein, His-tagged | +Inquiry |
BDKRB2-89C | Recombinant Cynomolgus Monkey BDKRB2 Protein, His (Fc)-Avi-tagged | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews
- Q&As
Ask a Question for All BDKRB2 Products
Required fields are marked with *
My Review for All BDKRB2 Products
Required fields are marked with *
0
Inquiry Basket