Recombinant Full Length Rabbit Cytotoxic T-Lymphocyte Protein 4(Ctla4) Protein, His-Tagged
| Cat.No. : | RFL22810OF |
| Product Overview : | Recombinant Full Length Rabbit Cytotoxic T-lymphocyte protein 4(CTLA4) Protein (P42072) (36-223aa), fused to N-terminal His tag, was expressed in E. coli. |
- Specification
- Gene Information
- Related Products
- Download
| Species : | Oryctolagus cuniculus |
| Source : | E.coli |
| Tag : | His |
| Protein Length : | Full Length of Mature Protein (36-223) |
| Form : | Lyophilized powder |
| AA Sequence : | KALHVSQPAVVLASSRGVASFVCEYASSHKATEVRVTVLRQANSQMTEVCAMTYTVENELTFIDDSTCTGISHGNKVNLTIQGLSAMDTGLYICKVELMYPPPYYVGMGNGTQIYVIEPEPCPDSDFLLWILAAISSGLFFYSFLITAVSLSKMLKKRSPLTTGVYVKMPPTEPECEKQFQPYFIPIN |
| Purity : | Greater than 90% as determined by SDS-PAGE. |
| Applications : | SDS-PAGE |
| Notes : | Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week. |
| Storage : | Store at -20°C/-80°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. |
| Storage Buffer : | Tris/PBS-based buffer, 6% Trehalose, pH 8.0 |
| Reconstitution : | We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20℃/-80℃. Our default final concentration of glycerol is 50%. Customers could use it as reference. |
| Gene Name | CTLA4 |
| Synonyms | CTLA4; Cytotoxic T-lymphocyte protein 4; Cytotoxic T-lymphocyte-associated antigen 4; CTLA-4; CD antigen CD152 |
| UniProt ID | P42072 |
| ◆ Recombinant Proteins | ||
| CTLA4-1061CF | Recombinant Canine CTLA4 Protein, His-tagged, FITC conjugated | +Inquiry |
| CTLA4-257H | Active Recombinant Human CTLA4 Protein, His-Avi-tagged, Biotinylated | +Inquiry |
| Ctla4-650H | Recombinant Human Ctla4 Protein, Fc-tagged | +Inquiry |
| Ctla4-3261MAF555 | Recombinant Mouse Ctla4 Protein, hFc-tagged, Alexa Fluor 555 conjugated | +Inquiry |
| CTLA4-1060CAF555 | Recombinant Canine CTLA4 Protein, Fc-tagged, Alexa Fluor 555 conjugated | +Inquiry |
| ◆ Native Proteins | ||
| CTLA4-35H | Active Recombinant Human CTLA4 Homodimer Protein, His tagged | +Inquiry |
| CTLA4-36M | Active Recombinant Mouse CTLA4 Homodimer Protein, His tagged | +Inquiry |
| ◆ Cell & Tissue Lysates | ||
| CTLA4-1047CCL | Recombinant Cynomolgus CTLA4 cell lysate | +Inquiry |
| CTLA4-2526HCL | Recombinant Human CTLA4 cell lysate | +Inquiry |
| CTLA4-2179MCL | Recombinant Mouse CTLA4 cell lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews (0)
- Q&As (0)
Ask a Question for All CTLA4 Products
Required fields are marked with *
My Review for All CTLA4 Products
Required fields are marked with *
