Recombinant Full Length Rabbit T-Cell-Specific Surface Glycoprotein Cd28(Cd28) Protein, His-Tagged
| Cat.No. : | RFL29096OF | 
| Product Overview : | Recombinant Full Length Rabbit T-cell-specific surface glycoprotein CD28(CD28) Protein (P42069) (20-221aa), fused to N-terminal His tag, was expressed in E. coli. | 
- Specification
 - Gene Information
 - Related Products
 - Download
 
| Species : | Oryctolagus cuniculus | 
| Source : | E.coli | 
| Tag : | His | 
| Protein Length : | Full Length of Mature Protein (20-221) | 
| Form : | Lyophilized powder | 
| AA Sequence : | NKILVKQSPMLVVNNNEVNLSCKYTYNLFSKEFRASLYKGADSAVEVCVVNGNFSHPHQFHSTTGFNCDGKLGNETVTFYLKNLYVNQTDIYFCKIEVMYPPPYLDNEKSNGTIIHVKEQHFCPAHPSPKSSTLFWVLVVVGAVLAFYSMLVTVALFSCWMKSKKNRLLQSDYMNMTPRRPGPTRKHYQPYAPARDFAAYRS | 
| Purity : | Greater than 90% as determined by SDS-PAGE. | 
| Applications : | SDS-PAGE | 
| Notes : | Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week. | 
| Storage : | Store at -20°C/-80°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. | 
| Storage Buffer : | Tris/PBS-based buffer, 6% Trehalose, pH 8.0 | 
| Reconstitution : | We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20℃/-80℃. Our default final concentration of glycerol is 50%. Customers could use it as reference. | 
| Gene Name | CD28 | 
| Synonyms | CD28; T-cell-specific surface glycoprotein CD28; CD antigen CD28 | 
| UniProt ID | P42069 | 
| ◆ Recombinant Proteins | ||
| CD28-1100RAF555 | Recombinant Rat CD28 Protein, His-tagged, Alexa Fluor 555 conjugated | +Inquiry | 
| CD28-1204CAF555 | Recombinant Monkey CD28 Protein, Fc-tagged, Alexa Fluor 555 conjugated | +Inquiry | 
| Cd28-4008MAF488 | Recombinant Mouse Cd28 Protein, His-tagged, Alexa Fluor 488 conjugated | +Inquiry | 
| CD28-3095HF | Recombinant Full Length Human CD28 Protein, GST-tagged | +Inquiry | 
| CD28-733R | Recombinant Rhesus monkey CD28 Protein, His-tagged | +Inquiry | 
| ◆ Native Proteins | ||
| CD28-22H | Active Recombinant Human CD28 Homodimer Protein, His tagged | +Inquiry | 
| Cd28-23M | Active Recombinant Mouse CD28 Homodimer Protein, His tagged | +Inquiry | 
| ◆ Cell & Tissue Lysates | ||
| CD28-2013HCL | Recombinant Human CD28 cell lysate | +Inquiry | 
| CD28-2002MCL | Recombinant Mouse CD28 cell lysate | +Inquiry | 
Not For Human Consumption!
Inquiry
- Reviews (0)
 - Q&As (0)
 
Ask a Question for All CD28 Products
Required fields are marked with *
My Review for All CD28 Products
Required fields are marked with *
  
        
    
      
            