Recombinant Full Length Rabbit T-Cell-Specific Surface Glycoprotein Cd28(Cd28) Protein, His-Tagged
| Cat.No. : | RFL29096OF |
| Product Overview : | Recombinant Full Length Rabbit T-cell-specific surface glycoprotein CD28(CD28) Protein (P42069) (20-221aa), fused to N-terminal His tag, was expressed in E. coli. |
- Specification
- Gene Information
- Related Products
- Download
| Species : | Oryctolagus cuniculus |
| Source : | E.coli |
| Tag : | His |
| Protein Length : | Full Length of Mature Protein (20-221) |
| Form : | Lyophilized powder |
| AA Sequence : | NKILVKQSPMLVVNNNEVNLSCKYTYNLFSKEFRASLYKGADSAVEVCVVNGNFSHPHQFHSTTGFNCDGKLGNETVTFYLKNLYVNQTDIYFCKIEVMYPPPYLDNEKSNGTIIHVKEQHFCPAHPSPKSSTLFWVLVVVGAVLAFYSMLVTVALFSCWMKSKKNRLLQSDYMNMTPRRPGPTRKHYQPYAPARDFAAYRS |
| Purity : | Greater than 90% as determined by SDS-PAGE. |
| Applications : | SDS-PAGE |
| Notes : | Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week. |
| Storage : | Store at -20°C/-80°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. |
| Storage Buffer : | Tris/PBS-based buffer, 6% Trehalose, pH 8.0 |
| Reconstitution : | We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20℃/-80℃. Our default final concentration of glycerol is 50%. Customers could use it as reference. |
| Gene Name | CD28 |
| Synonyms | CD28; T-cell-specific surface glycoprotein CD28; CD antigen CD28 |
| UniProt ID | P42069 |
| ◆ Recombinant Proteins | ||
| CD28-640M | Recombinant Mouse CD28, Fc-His tagged | +Inquiry |
| CD28-1100RAF647 | Recombinant Rat CD28 Protein, His-tagged, Alexa Fluor 647 conjugated | +Inquiry |
| CD28-336H | Active Recombinant Human/Cynomolgus/Rhesus macaque CD28 protein, mFc-tagged, low endotoxin | +Inquiry |
| RFL13001FF | Recombinant Full Length Cat T-Cell-Specific Surface Glycoprotein Cd28(Cd28) Protein, His-Tagged | +Inquiry |
| CD28-0772H | Recombinant Human CD28 Protein | +Inquiry |
| ◆ Native Proteins | ||
| Cd28-23M | Active Recombinant Mouse CD28 Homodimer Protein, His tagged | +Inquiry |
| ◆ Cell & Tissue Lysates | ||
| CD28-2002MCL | Recombinant Mouse CD28 cell lysate | +Inquiry |
| CD28-2013HCL | Recombinant Human CD28 cell lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews (0)
- Q&As (0)
Ask a Question for All CD28 Products
Required fields are marked with *
My Review for All CD28 Products
Required fields are marked with *
