Recombinant Full Length Rabbit T-Lymphocyte Activation Antigen Cd80(Cd80) Protein, His-Tagged
Cat.No. : | RFL4268OF |
Product Overview : | Recombinant Full Length Rabbit T-lymphocyte activation antigen CD80(CD80) Protein (P42070) (33-299aa), fused to N-terminal His tag, was expressed in E. coli. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Oryctolagus cuniculus |
Source : | E.coli |
Tag : | His |
Protein Length : | Full Length of Mature Protein (33-299) |
Form : | Lyophilized powder |
AA Sequence : | GISQVTKSVKEMAALSCDYNISIDELARMRIYWQKDQQMVLSIISGQVEVWPEYKNRTFPDIINNLSLMILALRLSDKGTYTCVVQKNENGSFRREHLTSVTLSIRADFPVPSITDIGHPDPNVKRIRCSASGGFPEPRLAWMEDGEELNAVNTTVDQDLDTELYSVSSELDFNVTNNHSIVCLIKYGELSVSQIFPWSKPKQEPPIDQLPFWVIIPVSGALVLTAVVLYCLACRHVARWKRTRRNEETVGTERLSPIYLGSAQSSG |
Purity : | Greater than 90% as determined by SDS-PAGE. |
Applications : | SDS-PAGE |
Notes : | Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week. |
Storage : | Store at -20°C/-80°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. |
Storage Buffer : | Tris/PBS-based buffer, 6% Trehalose, pH 8.0 |
Reconstitution : | We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20℃/-80℃. Our default final concentration of glycerol is 50%. Customers could use it as reference. |
Gene Name | CD80 |
Synonyms | CD80; T-lymphocyte activation antigen CD80; Activation B7-1 antigen; CD antigen CD80 |
UniProt ID | P42070 |
◆ Recombinant Proteins | ||
CD80-1213C | Recombinant Cynomolgus CD80 Protein, His-tagged | +Inquiry |
CD80-591HF | Recombinant Human CD80 Protein, His-tagged, FITC conjugated | +Inquiry |
RFL8683HF | Recombinant Full Length Human T-Lymphocyte Activation Antigen Cd80(Cd80) Protein, His-Tagged | +Inquiry |
CD80-1213CAF555 | Recombinant Cynomolgus CD80 Protein, His-tagged, Alexa Fluor 555 conjugated | +Inquiry |
CD80-617H | Active Recombinant Human CD80, HIgG1 Fc-tagged | +Inquiry |
◆ Cell & Tissue Lysates | ||
CD80-948CCL | Recombinant Cynomolgus CD80 cell lysate | +Inquiry |
CD80-2715HCL | Recombinant Human CD80 cell lysate | +Inquiry |
CD80-1767MCL | Recombinant Mouse CD80 cell lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews (0)
- Q&As (0)
Ask a Question for All CD80 Products
Required fields are marked with *
My Review for All CD80 Products
Required fields are marked with *