Recombinant Full Length Rat 1-Acyl-Sn-Glycerol-3-Phosphate Acyltransferase Delta(Agpat4) Protein, His-Tagged
Cat.No. : | RFL34728RF |
Product Overview : | Recombinant Full Length Rat 1-acyl-sn-glycerol-3-phosphate acyltransferase delta(Agpat4) Protein (Q924S1) (1-378aa), fused to N-terminal His tag, was expressed in E. coli. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Rat |
Source : | E.coli |
Tag : | His |
Protein Length : | Full Length (1-378) |
Form : | Lyophilized powder |
AA Sequence : | MDLIGLLKSQFLCHLVFCYVFIASGLIVNAIQLCTLVIWPINKQLFRKINARLCYCVSSQ LVMLLEWWSGTECTIYTDPKASPHYGKENAIVVLNHKFEIDFLCGWSLAERLGILGNSKV LAKKELAYVPIIGWMWYFVEMIFCTRKWEQDRQTVAKSLLHLRDYPEKYLFLIHCEGTRF TEKKHQISMQVAQAKGLPSLKHHLLPRTKGFAITVKCLRDVVPAVYDCTLNFRNNENPTL LGVLNGKKYHADCYVRRIPMEDIPEDEDKCSAWLHKLYQEKDAFQEEYYRTGVFPETPWV PPRRPWSLVNWLFWASLLLYPFFQFLVSMVSSGSSVTLASLVLIFCMASMGVRWMIGVTE IDKGSAYGNIDNKRKQTD |
Purity : | Greater than 90% as determined by SDS-PAGE. |
Notes : | Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week. |
Storage : | Store at -20°C/-80°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. |
Storage Buffer : | Tris/PBS-based buffer, 6% Trehalose, pH 8.0 |
Reconstitution : | We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20℃/-80℃. Our default final concentration of glycerol is 50%. Customers could use it as reference. |
Gene Name | Agpat4 |
Synonyms | Agpat4; 1-acyl-sn-glycerol-3-phosphate acyltransferase delta; 1-acylglycerol-3-phosphate O-acyltransferase 4; 1-AGP acyltransferase 4; 1-AGPAT 4; Lysophosphatidic acid acyltransferase delta; LPAAT-delta |
UniProt ID | Q924S1 |
◆ Recombinant Proteins | ||
RFL23765HF | Recombinant Full Length Human 1-Acyl-Sn-Glycerol-3-Phosphate Acyltransferase Delta(Agpat4) Protein, His-Tagged | +Inquiry |
AGPAT4-9476H | Recombinant Human AGPAT4, GST-tagged | +Inquiry |
AGPAT4-561R | Recombinant Rat AGPAT4 Protein | +Inquiry |
AGPAT4-284C | Recombinant Cynomolgus AGPAT4 Protein, His-tagged | +Inquiry |
AGPAT4-390M | Recombinant Mouse AGPAT4 Protein, His (Fc)-Avi-tagged | +Inquiry |
◆ Cell & Tissue Lysates | ||
AGPAT4-8975HCL | Recombinant Human AGPAT4 293 Cell Lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews
- Q&As
Ask a Question for All Agpat4 Products
Required fields are marked with *
My Review for All Agpat4 Products
Required fields are marked with *
0
Inquiry Basket