Recombinant Human AGPAT4 Full Length Transmembrane protein, His-tagged
Cat.No. : | AGPAT4-1048H |
Product Overview : | Recombinant Human AGPAT4 protein(Q9NRZ5)(1-319aa), fused with N-terminal His tag, was expressed in in vitro E. coli expression system. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Human |
Source : | E.coli |
Tag : | His |
Protein Length : | 1-319aa |
Form : | If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0. |
Molecular Mass : | 45.5 kDa |
AA Sequence : | MDLAGLLKSQFLCHLVFCYVFIASGLIINTIQLFTLLLWPINKQLFRKINCRLSYCISSQLVMLLEWWSGTECTIFTDPRAYLKYGKENAIVVLNHKFEIDFLCGWSLSERFGLLGGSKVLAKKELAYVPIIGWMWYFTEMVFCSRKWEQDRKTVATSLQHLRDYPEKYFFLIHCEGTRFTEKKHEISMQVARAKGLPRLKHHLLPRTKGFAITVRSLRNVVSAVYDCTLNFRNNENPTLLGVLNGKKYHADLYVRRIPLEDIPEDDDECSAWLHKLYQEKDAFQEEYYRTGTFPETPMVPPRRPWTLVNWLFWASLVLYPFFQFLVSMIRSGSSLTLASFILVFFVASVGVRWMIGVTEIDKGSAYGNSDSKQKLND- |
Purity : | Greater than 85% as determined by SDS-PAGE. |
Storage : | Store at -20°C/-80°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. |
Reconstitution : | Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20°C/-80°C. |
Gene Name | AGPAT4 1-acylglycerol-3-phosphate O-acyltransferase 4 (lysophosphatidic acid acyltransferase, delta) [ Homo sapiens ] |
Official Symbol | AGPAT4 |
Synonyms | AGPAT4; 1-acylglycerol-3-phosphate O-acyltransferase 4 (lysophosphatidic acid acyltransferase, delta); 1-acyl-sn-glycerol-3-phosphate acyltransferase delta; dJ473J16.2; LPAAT delta; 1-AGPAT 4; 1-AGP acyltransferase 4; lysophosphatidic acid acyltransferase delta; lysophosphatidic acid acyltransferase-delta (LPAAT-delta); 1-AGPAT4; LPAAT-delta; RP3-473J16.2; |
Gene ID | 56895 |
mRNA Refseq | NM_020133 |
Protein Refseq | NP_064518 |
UniProt ID | Q9NRZ5 |
◆ Recombinant Proteins | ||
AGPAT4-9476H | Recombinant Human AGPAT4, GST-tagged | +Inquiry |
AGPAT4-932HF | Recombinant Full Length Human AGPAT4 Protein, GST-tagged | +Inquiry |
AGPAT4-34C | Recombinant Cynomolgus Monkey AGPAT4 Protein, His (Fc)-Avi-tagged | +Inquiry |
AGPAT4-1048H | Recombinant Human AGPAT4 Full Length Transmembrane protein, His-tagged | +Inquiry |
AGPAT4-561R | Recombinant Rat AGPAT4 Protein | +Inquiry |
◆ Cell & Tissue Lysates | ||
AGPAT4-8975HCL | Recombinant Human AGPAT4 293 Cell Lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews (0)
- Q&As (0)
Ask a Question for All AGPAT4 Products
Required fields are marked with *
My Review for All AGPAT4 Products
Required fields are marked with *