Recombinant Full Length Rat 3 Beta-Hydroxysteroid Dehydrogenase Type 5(Hsd3B5) Protein, His-Tagged
Cat.No. : | RFL10704RF |
Product Overview : | Recombinant Full Length Rat 3 beta-hydroxysteroid dehydrogenase type 5(Hsd3b5) Protein (P27364) (2-373aa), fused to N-terminal His tag, was expressed in E. coli. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Rat |
Source : | E.coli |
Tag : | His |
Protein Length : | Full Length of Mature Protein (2-373) |
Form : | Lyophilized powder |
AA Sequence : | PGWSCLVTGAGGFLGQRIVQMLVQEKELQEVRVLYRTFSPKHKEELSKLQTKAKVTVLRG DIVDAQFLRRACQGMSVIIHTAAALDIAGFLPRQTILDVNVKGTQLLLDACVEASVPAFI YSSSTGVAGPNSYKETILNDREEEHRESTWSNPYPYSKRMAEKAVLAANGSILKNGGTFH TCALRLPFIYGEESQIISTMVNRALKNNSIIKRHATFSIANPVYVGNAAWAHILAARGLR DPEKSQSIQGQFYYISDDTPHQSYDDLNYTLSKEWGFCLDSSWSLPLPLLYWLAFLLETV SFLLRPFYNYRPPFNRFMVTILNSVFTISYKKAQRDLGYEPLVSWEEAKQKTSEWIGTLV EQHRETLDTKSQ |
Purity : | Greater than 90% as determined by SDS-PAGE. |
Applications : | SDS-PAGE |
Notes : | Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week. |
Storage : | Store at -20°C/-80°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. |
Storage Buffer : | Tris/PBS-based buffer, 6% Trehalose, pH 8.0 |
Reconstitution : | We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20℃/-80℃. Our default final concentration of glycerol is 50%. Customers could use it as reference. |
Gene Name | Hsd3b5 |
Synonyms | Hsd3b5; Hsd3b; NADPH-dependent 3-keto-steroid reductase Hsd3b5; 3 beta-hydroxysteroid dehydrogenase type 3; 3 beta-hydroxysteroid dehydrogenase type III; 3 beta-HSD III; Dihydrotestosterone 3-ketoreductase |
UniProt ID | P27364 |
◆ Recombinant Proteins | ||
HSD3B5-4342M | Recombinant Mouse HSD3B5 Protein, His (Fc)-Avi-tagged | +Inquiry |
RFL10704RF | Recombinant Full Length Rat 3 Beta-Hydroxysteroid Dehydrogenase Type 5(Hsd3B5) Protein, His-Tagged | +Inquiry |
RFL34258MF | Recombinant Full Length Mouse 3 Beta-Hydroxysteroid Dehydrogenase Type 5(Hsd3B5) Protein, His-Tagged | +Inquiry |
HSD3B5-7886M | Recombinant Mouse HSD3B5 Protein | +Inquiry |
HSD3B5-2934R | Recombinant Rat HSD3B5 Protein | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews (0)
- Q&As (0)
Ask a Question for All Hsd3b5 Products
Required fields are marked with *
My Review for All Hsd3b5 Products
Required fields are marked with *