Recombinant Full Length Rat Activator Of Apoptosis Harakiri(Hrk) Protein, His-Tagged
Cat.No. : | RFL7252RF |
Product Overview : | Recombinant Full Length Rat Activator of apoptosis harakiri(Hrk) Protein (P62817) (1-92aa), fused to N-terminal His tag, was expressed in E. coli. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Rat |
Source : | E.coli |
Tag : | His |
Protein Length : | Full Length (1-92) |
Form : | Lyophilized powder |
AA Sequence : | MCPCPRHRGRGPPAVCGCGDARPGLRWAAAQVTALRLQALGDELHRRAMRRRARPRDPLP ALLPALRARWPWLCAAAQVAALAAWLLGRRSA |
Purity : | Greater than 90% as determined by SDS-PAGE. |
Applications : | SDS-PAGE |
Notes : | Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week. |
Storage : | Store at -20°C/-80°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. |
Storage Buffer : | Tris/PBS-based buffer, 6% Trehalose, pH 8.0 |
Reconstitution : | We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20℃/-80℃. Our default final concentration of glycerol is 50%. Customers could use it as reference. |
Gene Name | Hrk |
Synonyms | Hrk; Bid3; Dp5; Activator of apoptosis harakiri; BH3-interacting domain-containing protein 3; Neuronal death protein DP5 |
UniProt ID | P62817 |
◆ Recombinant Proteins | ||
HRK-3670HF | Recombinant Full Length Human HRK Protein, GST-tagged | +Inquiry |
HRK-5039H | Recombinant Human HRK Protein, GST-tagged | +Inquiry |
RFL33284MF | Recombinant Full Length Mouse Activator Of Apoptosis Harakiri(Hrk) Protein, His-Tagged | +Inquiry |
HRK-2914R | Recombinant Rat HRK Protein | +Inquiry |
Hrk-3115B | Recombinant Bovine Hrk, GST-tagged | +Inquiry |
◆ Cell & Tissue Lysates | ||
HRK-5391HCL | Recombinant Human HRK 293 Cell Lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews (0)
- Q&As (0)
Ask a Question for All Hrk Products
Required fields are marked with *
My Review for All Hrk Products
Required fields are marked with *
0
Inquiry Basket