Recombinant Human HRK Protein, GST-tagged

• Cat.No.: HRK-5039H
• Product Overview: Human HRK full-length ORF ( AAI11924.1, 1 a.a. - 91 a.a.) recombinant protein with GST-tag at N-terminal.

Specification

• Species: Human
• Source: Wheat Germ
• Tag: GST
• Description: Activator of apoptosis Hrk regulates apoptosis through interaction with death-repressor proteins Bcl-2 and Bcl-X(L). The HRK protein lacks significant homology to other BCL2 family members except for an 8-amino acid region that was similar to the BCL2 homology domain-3 (BH3) motif of BIK. HRK interacts with BCL2 and BCLXL via the BH3 domain, but not with the death-promoting BCL2-related proteins BAX, BAK, or BCLXS. HRK localizes to membranes of intracellular organelles in a pattern similar to that previously reported for BCL2 and BCLXL. [provided by RefSeq
• Molecular Mass: 36.41 kDa
• AA Sequence: MCPCPLHRGRGPPAVCACSAGRLGLRSSAAQLTAARLKALGDELHQRTMWRRRARSRRAPAPGALPTYWPWLCAAAQVAALAAWLLGRRNL
• Applications: Enzyme-linked Immunoabsorbent Assay
  Western Blot (Recombinant protein)
  Antibody Production
  Protein Array
• Notes: Best use within three months from the date of receipt of this protein.
• Storage: Store at -8 centigrade. Aliquot to avoid repeated freezing and thawing.
• Storage Buffer: 50 mM Tris-HCI, 10 mM reduced Glutathione, pH=8.0 in the elution buffer.

Gene Information

• Gene Name: HRK harakiri, BCL2 interacting protein (contains only BH3 domain) [ Homo sapiens ]
• Official Symbol: HRK
• Synonyms: HRK; harakiri, BCL2 interacting protein (contains only BH3 domain); activator of apoptosis harakiri; death protein 5; DP5; BCL2-interacting protein; activator of apoptosis Hrk; neuronal death protein DP5; BH3-interacting domain-containing protein 3; HARAKIRI
• Gene ID: 8739
• mRNA Refseq: NM_003806
• Protein Refseq: NP_003797
• MIM: 603447
• UniProt ID: O00198