Recombinant Human HRK Protein, GST-tagged

Cat.No. : HRK-5039H
Product Overview : Human HRK full-length ORF ( AAI11924.1, 1 a.a. - 91 a.a.) recombinant protein with GST-tag at N-terminal.
  • Specification
  • Gene Information
  • Related Products
  • Download
Species : Human
Source : Wheat Germ
Tag : GST
Description : Activator of apoptosis Hrk regulates apoptosis through interaction with death-repressor proteins Bcl-2 and Bcl-X(L). The HRK protein lacks significant homology to other BCL2 family members except for an 8-amino acid region that was similar to the BCL2 homology domain-3 (BH3) motif of BIK. HRK interacts with BCL2 and BCLXL via the BH3 domain, but not with the death-promoting BCL2-related proteins BAX, BAK, or BCLXS. HRK localizes to membranes of intracellular organelles in a pattern similar to that previously reported for BCL2 and BCLXL. [provided by RefSeq
Molecular Mass : 36.41 kDa
AA Sequence : MCPCPLHRGRGPPAVCACSAGRLGLRSSAAQLTAARLKALGDELHQRTMWRRRARSRRAPAPGALPTYWPWLCAAAQVAALAAWLLGRRNL
Applications : Enzyme-linked Immunoabsorbent Assay
Western Blot (Recombinant protein)
Antibody Production
Protein Array
Notes : Best use within three months from the date of receipt of this protein.
Storage : Store at -8 centigrade. Aliquot to avoid repeated freezing and thawing.
Storage Buffer : 50 mM Tris-HCI, 10 mM reduced Glutathione, pH=8.0 in the elution buffer.
Gene Name HRK harakiri, BCL2 interacting protein (contains only BH3 domain) [ Homo sapiens ]
Official Symbol HRK
Synonyms HRK; harakiri, BCL2 interacting protein (contains only BH3 domain); activator of apoptosis harakiri; death protein 5; DP5; BCL2-interacting protein; activator of apoptosis Hrk; neuronal death protein DP5; BH3-interacting domain-containing protein 3; HARAKIRI;
Gene ID 8739
mRNA Refseq NM_003806
Protein Refseq NP_003797
MIM 603447
UniProt ID O00198

Not For Human Consumption!

Inquiry

  • Reviews (0)
  • Q&As (0)

Customer Reviews

Write a review

Ask a Question for All HRK Products

Required fields are marked with *

My Review for All HRK Products

Required fields are marked with *

0
cart-icon