Recombinant Full Length Rat Apoptosis Regulator Bax(Bax) Protein, His-Tagged
Cat.No. : | RFL25339RF |
Product Overview : | Recombinant Full Length Rat Apoptosis regulator BAX(Bax) Protein (Q63690) (1-192aa), fused to N-terminal His tag, was expressed in E. coli. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Rat |
Source : | E.coli |
Tag : | His |
Protein Length : | Full Length (1-192) |
Form : | Lyophilized powder |
AA Sequence : | MDGSGEQLGGGGPTSSEQIMKTGAFLLQGFIQDRAGRMAGETPELTLEQPPQDASTKKLS ECLRRIGDELDSNMELQRMIADVDTDSPREVFFRVAADMFADGNFNWGRVVALFYFASKL VLKALCTKVPELIRTIMGWTLDFLRERLLVWIQDQGGWDGLLSYFGTPTWQTVTIFVAGV LTASLTIWKKMG |
Purity : | Greater than 90% as determined by SDS-PAGE. |
Notes : | Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week. |
Storage : | Store at -20°C/-80°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. |
Storage Buffer : | Tris/PBS-based buffer, 6% Trehalose, pH 8.0 |
Reconstitution : | We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20℃/-80℃. Our default final concentration of glycerol is 50%. Customers could use it as reference. |
Gene Name | Bax |
Synonyms | Bax; Apoptosis regulator BAX |
UniProt ID | Q63690 |
◆ Recombinant Proteins | ||
RFL25339RF | Recombinant Full Length Rat Apoptosis Regulator Bax(Bax) Protein, His-Tagged | +Inquiry |
BAX-26650TH | Recombinant Human BAX protein, GST-tagged | +Inquiry |
BAX-6975H | Recombinant Human BAX, GST-tagged | +Inquiry |
Bax-299M | Recombinant Mouse Bax Protein, His-tagged | +Inquiry |
Bax-244M | Recombinant Mouse BCL2-associated X Protein | +Inquiry |
◆ Native Proteins | ||
BAX-20H | Recombinant Full Length Human BAX Protein, His tagged | +Inquiry |
◆ Cell & Tissue Lysates | ||
BAX-8506HCL | Recombinant Human BAX 293 Cell Lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews (0)
- Q&As (0)
Ask a Question for All Bax Products
Required fields are marked with *
My Review for All Bax Products
Required fields are marked with *