Recombinant Full Length Rat Calcitonin Receptor(Calcr) Protein, His-Tagged
Cat.No. : | RFL24242RF |
Product Overview : | Recombinant Full Length Rat Calcitonin receptor(Calcr) Protein (P32214) (25-516aa), fused to N-terminal His tag, was expressed in E. coli. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Rat |
Source : | E.coli |
Tag : | His |
Protein Length : | Full Length of Mature Protein (25-516) |
Form : | Lyophilized powder |
AA Sequence : | APTNLTDSGLDQEPFLYLVGRKKLLDAQYKCYDRIQQLPPYEGEGPYCNRTWDGWMCWDD TPAGVMSYQHCPDYFPDFDPTEKVSKYCDENGEWFRHPDSNRTWSNYTLCNAFTPDKLHN AYVLYYLALVGHSMSIAALIASMGIFLFFKNLSCQRVTLHKNMFLTYILNSIIIIIHLVE VVPNGDLVRRDPMHIFHHNTYMWTMQWELSPPLPLSAHEGKMDPHDSEVISCKILHFFHQ YMMACNYFWMLCEGIYLHTLIVMAVFTEDQRLRWYYLLGWGFPIVPTIIHAITRAVYYND NCWLSTETHLLYIIHGPVMAALVVNFFFLLNIVRVLVTKMRQTHEAEAYMYLKAVKATMV LVPLLGIQFVVFPWRPSNKVLGKIYDYLMHSLIHFQGFFVATIYCFCNHEVQVTLKRQWA QFKIQWSHRWGRRRRPTNRVVSAPRAVAFAEPGGLPIYICHQEPRNPPVSNNEGEEGTEM IPMNVIQQDSSA |
Purity : | Greater than 90% as determined by SDS-PAGE. |
Applications : | SDS-PAGE |
Notes : | Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week. |
Storage : | Store at -20°C/-80°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. |
Storage Buffer : | Tris/PBS-based buffer, 6% Trehalose, pH 8.0 |
Reconstitution : | We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20℃/-80℃. Our default final concentration of glycerol is 50%. Customers could use it as reference. |
Gene Name | Calcr |
Synonyms | Calcr; Calcitonin receptor; CT-R; C1A/C1B |
UniProt ID | P32214 |
◆ Recombinant Proteins | ||
CALCR-742H | Recombinant Human CALCR Protein, Fc-tagged | +Inquiry |
RFL25734MF | Recombinant Full Length Mouse Calcitonin Receptor(Calcr) Protein, His-Tagged | +Inquiry |
CALCR-743H | Recombinant Human CALCR Protein, Fc-tagged | +Inquiry |
CALCR-27793TH | Recombinant Human CALCR | +Inquiry |
CALCR-3051HF | Recombinant Full Length Human CALCR Protein, GST-tagged | +Inquiry |
◆ Cell & Tissue Lysates | ||
CALCR-272HCL | Recombinant Human CALCR cell lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews
- Q&As
Ask a Question for All Calcr Products
Required fields are marked with *
My Review for All Calcr Products
Required fields are marked with *
0
Inquiry Basket