Recombinant Full Length Rat Cd63 Antigen(Cd63) Protein, His-Tagged
| Cat.No. : | RFL36047RF | 
| Product Overview : | Recombinant Full Length Rat CD63 antigen(Cd63) Protein (P28648) (2-238aa), fused to N-terminal His tag, was expressed in E. coli. | 
- Specification
 - Gene Information
 - Related Products
 - Download
 
| Species : | Rat | 
| Source : | E.coli | 
| Tag : | His | 
| Protein Length : | Full Length of Mature Protein (2-238) | 
| Form : | Lyophilized powder | 
| AA Sequence : | AVEGGMKCVKFLLYVLLLAFCACAVGLIAIGVAVQVVLKQAITHETTAGSLLPVVIIAVG AFLFLVAFVGCCGACKENYCLMITFAIFLSLIMLVEVAVAIAGYVFRDQVKSEFSKSFQK QMQNYLTDNKTATILDKLQKENKCCGASNYTDWERIPGMAKDRVPDSCCINITVGCGNDF KESTIHTQGCVETIAAWLRKNVLLVAGAALGIAFVEVLGIIFSCCLVKSIRSGYEVM | 
| Purity : | Greater than 90% as determined by SDS-PAGE. | 
| Applications : | SDS-PAGE | 
| Notes : | Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week. | 
| Storage : | Store at -20°C/-80°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. | 
| Storage Buffer : | Tris/PBS-based buffer, 6% Trehalose, pH 8.0 | 
| Reconstitution : | We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20℃/-80℃. Our default final concentration of glycerol is 50%. Customers could use it as reference. | 
| Gene Name | Cd63 | 
| Synonyms | Cd63; CD63 antigen; Mast cell antigen AD1; CD antigen CD63 | 
| UniProt ID | P28648 | 
| ◆ Recombinant Proteins | ||
| CD63-1261R | Recombinant Rat CD63 protein, His-tagged | +Inquiry | 
| CD63-3890H | Recombinant Human CD63 protein, His-tagged | +Inquiry | 
| CD63-1324H | Recombinant Human CD63 Protein (Ala103-Val203), N-GST tagged | +Inquiry | 
| CD63-2668H | Recombinant Human CD63 protein, His-tagged | +Inquiry | 
| CD63-570P | Recombinant Pig CD63 Protein, Fc-tagged | +Inquiry | 
| ◆ Cell & Tissue Lysates | ||
| CD63-1913HCL | Recombinant Human CD63 cell lysate | +Inquiry | 
| CD63-1553SCL | Recombinant Sus scrofa (Pig) CD63 cell lysate | +Inquiry | 
| CD63-001RCL | Recombinant Rat CD63 cell lysate | +Inquiry | 
| CD63-814CCL | Recombinant Cynomolgus CD63 cell lysate | +Inquiry | 
Not For Human Consumption!
Inquiry
- Reviews (0)
 - Q&As (0)
 
Ask a Question for All Cd63 Products
Required fields are marked with *
My Review for All Cd63 Products
Required fields are marked with *
  
        
    
      
            