Recombinant Full Length Rat Chemokine-Like Factor(Cklf) Protein, His-Tagged
Cat.No. : | RFL19313RF |
Product Overview : | Recombinant Full Length Rat Chemokine-like factor(Cklf) Protein (Q9JK79) (1-151aa), fused to N-terminal His tag, was expressed in E. coli. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Rat |
Source : | E.coli |
Tag : | His |
Protein Length : | Full Length (1-151) |
Form : | Lyophilized powder |
AA Sequence : | MDSPQKVVDHQPFCLSLKCFVKTLRLVVTVASMIFFIVAQAPEPYIVITGFEVTIILFLI ALYMCSLDKTMRSFFWPLLDVINSVVTTLFMLIVSVSALIPETSTMIMVGGVFGFLTVIC TVADCALMCQKLRFRPHGPYQNRSATDVDDS |
Purity : | Greater than 90% as determined by SDS-PAGE. |
Applications : | SDS-PAGE |
Notes : | Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week. |
Storage : | Store at -20°C/-80°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. |
Storage Buffer : | Tris/PBS-based buffer, 6% Trehalose, pH 8.0 |
Reconstitution : | We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20℃/-80℃. Our default final concentration of glycerol is 50%. Customers could use it as reference. |
Gene Name | Cklf |
Synonyms | Cklf; Cklf1; Chemokine-like factor |
UniProt ID | Q9JK79 |
◆ Recombinant Proteins | ||
RFL19313RF | Recombinant Full Length Rat Chemokine-Like Factor(Cklf) Protein, His-Tagged | +Inquiry |
CKLF-1406H | Recombinant Human CKLF | +Inquiry |
CKLF-3495M | Recombinant Mouse CKLF Protein | +Inquiry |
CKLF-1708M | Recombinant Mouse CKLF Protein, His (Fc)-Avi-tagged | +Inquiry |
CKLF-885R | Recombinant Rhesus monkey CKLF Protein, His-tagged | +Inquiry |
◆ Cell & Tissue Lysates | ||
CKLF-242H | C32 (human amelanotic melanoma) nuclear extract lysate | +Inquiry |
CKLF-7484HCL | Recombinant Human CKLF 293 Cell Lysate | +Inquiry |
CKLF-7485HCL | Recombinant Human CKLF 293 Cell Lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews (0)
- Q&As (0)
Ask a Question for All Cklf Products
Required fields are marked with *
My Review for All Cklf Products
Required fields are marked with *