Recombinant Full Length Rat Coiled-Coil Domain-Containing Protein 51(Ccdc51) Protein, His-Tagged
Cat.No. : | RFL25559RF |
Product Overview : | Recombinant Full Length Rat Coiled-coil domain-containing protein 51(Ccdc51) Protein (Q5PPN7) (1-410aa), fused to N-terminal His tag, was expressed in E. coli. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Rat |
Source : | E.coli |
Tag : | His |
Protein Length : | Full Length (1-410) |
Form : | Lyophilized powder |
AA Sequence : | MTGCSPVFTMQQVVGVSHRLVWRTFRGTDLLMTRTLCSPGPSRPGEKRPEAAALGLYHRL PELGRTLSHTIRNQAASTAKAWWDRYEEFVGLNEVREAQGNVTEAEKVFMVARGLVREAR EDLEAQQTKLKEVRDRLDRVSREDNQYLELATLEHRMLQEEKRLRIAYLRAEDSEREKFS LFSAAVRESHEKERTRAERTKNWSLIGSVLGALIGVAGSTYVNRVRLQELKALLLEAQKG PVSLQEAIREQASSYSLQQKDLQNLMVDLRGLVHVGQDQGSGSPTGPSSPRGKDIDGLSA AMKEQLNHSRQVYSCLEGLREQLDSLEKTCSQMAGVVRLAKVPAHPGMVEPLDGALPSSL LEHGSTMLALSEMEQRLEAQANRNAISSTLVTCVTFMATLPLLYMLFKTS |
Purity : | Greater than 90% as determined by SDS-PAGE. |
Notes : | Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week. |
Storage : | Store at -20°C/-80°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. |
Storage Buffer : | Tris/PBS-based buffer, 6% Trehalose, pH 8.0 |
Reconstitution : | We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20℃/-80℃. Our default final concentration of glycerol is 50%. Customers could use it as reference. |
Gene Name | Ccdc51 |
Synonyms | Ccdc51; Mitok; Mitochondrial potassium channel; MITOK; Coiled-coil domain-containing protein 51 |
UniProt ID | Q5PPN7 |
◆ Recombinant Proteins | ||
RFL6950MF | Recombinant Full Length Mouse Coiled-Coil Domain-Containing Protein 51(Ccdc51) Protein, His-Tagged | +Inquiry |
CCDC51-1343M | Recombinant Mouse CCDC51 Protein, His (Fc)-Avi-tagged | +Inquiry |
CCDC51-4404Z | Recombinant Zebrafish CCDC51 | +Inquiry |
Ccdc51-2009M | Recombinant Mouse Ccdc51 Protein, Myc/DDK-tagged | +Inquiry |
RFL15473BF | Recombinant Full Length Bovine Coiled-Coil Domain-Containing Protein 51(Ccdc51) Protein, His-Tagged | +Inquiry |
◆ Cell & Tissue Lysates | ||
CCDC51-7762HCL | Recombinant Human CCDC51 293 Cell Lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews (0)
- Q&As (0)
Ask a Question for All Ccdc51 Products
Required fields are marked with *
My Review for All Ccdc51 Products
Required fields are marked with *