Recombinant Full Length Rat Egf, Latrophilin And Seven Transmembrane Domain-Containing Protein 1(Eltd1) Protein, His-Tagged
| Cat.No. : | RFL35432RF |
| Product Overview : | Recombinant Full Length Rat EGF, latrophilin and seven transmembrane domain-containing protein 1(Eltd1) Protein (Q9ESC1) (455-738aa), fused to N-terminal His tag, was expressed in E. coli. |
- Specification
- Gene Information
- Related Products
- Download
| Species : | Rat |
| Source : | E.coli |
| Tag : | His |
| Protein Length : | Full Length of Mature Protein (455-738) |
| Form : | Lyophilized powder |
| AA Sequence : | THFAILMSPSTSIEVKDYNILTRITQLGIIISLICLAICIFTFWFFSEIQSTRTTIHKNL CCSLFLAQLVFLVGININTNKLVCSIIAGLLHYFFLAAFAWMCIEGIYLYLIVVGLIYNK GFLHKNFYIFGYLSPAVVVGFSASLGYRYYGTTKVCWLSTENNFIWSFIGPACLIILVNL LAFGVIIYKVFRHTAGLKPEVSCYENIRSCARGALALLFLLGTTWTFGVLHVVHASVVTA YLFTVSNAFQGMFIFLFLCVLSRKIQEEYYRLFKNVPCCFECLR |
| Purity : | Greater than 90% as determined by SDS-PAGE. |
| Notes : | Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week. |
| Storage : | Store at -20°C/-80°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. |
| Storage Buffer : | Tris/PBS-based buffer, 6% Trehalose, pH 8.0 |
| Reconstitution : | We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20℃/-80℃. Our default final concentration of glycerol is 50%. Customers could use it as reference. |
| Gene Name | Adgrl4 |
| Synonyms | Adgrl4; Eltd1; Etl; Adhesion G protein-coupled receptor L4; EGF,latrophilin and seven transmembrane domain-containing protein 1; EGF-TM7-latrophilin-related protein; ETL protein |
| UniProt ID | Q9ESC1 |
| ◆ Recombinant Proteins | ||
| ADGRL4-207H | Recombinant Human ADGRL4 protein, T7/His-tagged | +Inquiry |
| ADGRL4-4230HF | Recombinant Full Length Human ADGRL4 Protein, GST-tagged | +Inquiry |
| ADGRL4-3269H | Recombinant Human ADGRL4 Protein, GST-tagged | +Inquiry |
| ADGRL4-3268H | Recombinant Human ADGRL4 Protein | +Inquiry |
| RFL26423HF | Recombinant Full Length Human Adhesion G Protein-Coupled Receptor L4(Adgrl4) Protein, His-Tagged | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews (0)
- Q&As (0)
Ask a Question for All Adgrl4 Products
Required fields are marked with *
My Review for All Adgrl4 Products
Required fields are marked with *
